KEGG   Mus musculus (mouse): 19357
Entry
19357             CDS       T01002                                 

Symbol
Rad21, SCC, SCC1, mHR21, mKIAA0078
Name
(RefSeq) RAD21 cohesin complex component
  KO
K06670  cohesin complex subunit SCC1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    19357 (Rad21)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    19357 (Rad21)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Cohesin complex
    19357 (Rad21)
SSDB
Motif
Pfam: Rad21_Rec8_N Rad21_Rec8 SMC_ScpA
Other DBs
NCBI-GeneID: 19357
NCBI-ProteinID: NP_033035
MGI: 108016
Ensembl: ENSMUSG00000022314
UniProt: Q61550 Q3TG35
Position
15; 15 C
AA seq 635 aa
MFYAHFVLSKRGPLAKIWLAAHWDKKLTKAHVFECNLESSVESIISPKVKMALRTSGHLL
LGVVRIYHRKAKYLLADCNEAFIKIKMAFRPGVVDLPEENREAAYNAITLPEEFHDFDQP
LPDLDDIDVAQQFSLNQSRVEEITMREEVGNISILQENDFGDFGMDDREIMREGSAFEDD
DMLVSTSASNLLLEPEQSTSNLNEKMNHLEYEDQYKDDNFGEGNDGGILDDKLISNNDGG
IFDDPPALSEAGVMLPEQPAHDDMDEDDNGSLGGPDSPDSVDPVEPMPTMTDQTTLVPNE
EEAFALEPIDITVKETKAKRKRKLIVDSVKELDSKTIRAQLSDYSDIVTTLDLAPPTKKL
MMWKETGGVEKLFFLPAQPLWNNRLLKLFTRCLTPLVPEDLRKRRKGGEADNLDEFLKEF
ENPEVPREEQQPQQQQPQPQRDVIDEPIIEEPSRLQDSVMEASRTTIEESAMPPPPPQGV
KRKAGQIDPEPSIPPQQVEQMEIPPVELPPEEPPNICQLIPELELLPEKEKEKEKEKEEE
EEEEDEDASGGDQDQEERRWNKRTQQMLHGLQRALAKTGAESISLLELCRNTNRKQAAAK
FYSFLVLKKQQAIELTQEEPYSDIIATPGPRFHII
NT seq 1908 nt   +upstreamnt  +downstreamnt
atgttctacgcacattttgtcctcagtaaacgagggcctctggccaaaatctggctggcg
gcccattgggacaagaagctaaccaaagcccatgtatttgagtgcaacttagagagcagt
gtggagagcatcatctcaccaaaggtgaagatggcgctgcggacgtcaggacaccttctc
ctgggagtagtccgcatctatcacaggaaagccaaatacctcctcgcagactgtaatgaa
gcatttattaaaataaagatggcgtttcggccaggtgttgtcgatctacctgaggaaaat
cgggaagcagcttataatgccattactttacctgaggaattccacgattttgatcagcca
ctgccagatttagatgatattgacgtcgcccagcagttcagcctgaaccaaagcagagta
gaagagataaccatgagagaagaagtcggaaacatcagtatcctacaggaaaatgacttt
ggtgacttcggaatggatgaccgtgaaataatgagagaaggcagtgctttcgaggatgac
gacatgttagtgagcaccagcgcttccaaccttctcctcgagccagagcagagcaccagc
aacctgaatgaaaagatgaatcacttagagtacgaagaccagtacaaagatgacaatttt
ggagaaggaaatgatggcggtatattagatgacaaacttataagtaataatgatggtggc
atctttgacgatccccctgccttgtctgaggcaggggtcatgttgccagagcaacctgca
catgatgacatggatgaagatgacaatggctcactgggtgggccggatagtcccgactct
gtggatcctgtcgaaccgatgccaactatgactgatcagacaactctcgtcccaaacgag
gaagaagcttttgcgttggagcccattgatataactgtcaaagagacaaaagccaagagg
aagaggaagctgattgttgacagtgtcaaagaattggatagtaagaccattagagcccag
cttagcgattattctgatattgttacgactctggacctggctccgccaaccaagaagctt
atgatgtggaaagagacaggaggagtggaaaagctcttctttttaccagcacagcccctg
tggaataaccggctactgaagctcttcacacgctgccttaccccacttgtaccagaagac
cttaggaagagaaggaaagggggagaggcagataatctggatgagttcctcaaagagttt
gagaatccagaggttcccagagaggagcagcagccacagcagcagcagccacagccgcag
cgagatgtcatcgatgagcccattatagaagagccaagccgcctccaggactcagtgatg
gaggccagcagaacaaccatagaagaatcagccatgcccccaccaccccctcaaggagtt
aagcggaaagccgggcaaatagacccagagccttcgatacctcctcagcaggtagagcaa
atggaaataccaccagtagaacttcccccagaggagcctccaaatatctgtcagctgatc
ccggagttagagctcctaccggagaaggagaaggaaaaagagaaggagaaggaagaggag
gaggaggaggaggatgaagatgcttcagggggtgatcaggatcaagaggaaaggagatgg
aacaaacgcactcagcagatgcttcatggtcttcagcgagctcttgctaaaactggagca
gagtctatcagtttgcttgagctgtgtcgaaacacaaaccgaaagcaggcagcagcaaag
ttctacagctttttggttcttaagaagcagcaagccatcgagctcacacaggaagagccg
tacagtgacatcattgcaacccctggaccacggttccatattatctga

DBGET integrated database retrieval system