KEGG   Mus musculus (mouse): 193796
Entry
193796            CDS       T01002                                 

Gene name
Kdm4b, 4732474L06Rik, Jmjd2b
Definition
(RefSeq) lysine (K)-specific demethylase 4B
  KO
K06709  [histone H3]-trimethyl-L-lysine9/36 demethylase [EC:1.14.11.66 1.14.11.69]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    193796 (Kdm4b)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.66  [histone H3]-trimethyl-L-lysine9 demethylase
     193796 (Kdm4b)
    1.14.11.69  [histone H3]-trimethyl-L-lysine36 demethylase
     193796 (Kdm4b)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   Histone demethylases
    193796 (Kdm4b)
SSDB
Motif
Pfam: JmjC zf-HC5HC2H_2 Tudor_2 zf-HC5HC2H PHD_2 JmjN LBR_tudor PHD Tudor_3
Other DBs
NCBI-GeneID: 193796
NCBI-ProteinID: NP_742144
MGI: 2442355
Ensembl: ENSMUSG00000024201
Vega: OTTMUSG00000024381
UniProt: Q91VY5
Position
17; 17 D
AA seq 1086 aa
MGSEDHSAQNPSCKIMTFRPTMDEFRDFNRYVAYIESQGAHRAGLAKIIPPKEWKPRQTY
DDIDDVVIPAPIQQVVTGQSGLFTQYNIQKKAMTVGEYRRLANSEKYCTPRHQDFDDLER
KYWKNLTFVSPIYGADISGSLYDDDVAQWNIGNLRTILDMVERECGTIIEGVNTPYLYFG
MWKTTFAWHTEDMDLYSINYLHFGEPKSWYAIPPEHGKRLERLAIGFFPGSSQGCDAFLR
HKMTLISPIILKKYGIPFSRITQEAGEFMITFPYGYHAGFNHGFNCAESTNFATLRWIDY
GKVATQCTCRKDMVKISMDVFVRILQPERYEQWKQGRDLTVLDHTRPTALSSPELSSWSA
SRTSIKAKLLRRQISVKESRPWRKAEEERRREPTRRPGPASHRRRSQPKKSKPEESRSPG
EATAGVSTLDEARGCSRGEAMPEDEEEEELLPSQGHEAEGVEEDGRGKPRPTKARNKKKT
PSPSSPPLLSAPPALFPTEEVLRPPPQPKSPGPAMGPMAAEGGPPPTPLNVVPPGAPVEE
AEVRPRPIIPMLYVLPRTSSTDGDREHSAHAQLAPMELGPEEENQAQAGDSQGTTPFSKL
KVEIKKSRRHPLGRPPTRSPLSVVKQEASSDEEAFLFSGEDDVTDPEALRSLLSLQWKNK
AASFQAERKFNAAAALSEPYCAICTLFYPYSQSVQTERDSAVQPPSKSGQRTRPLIPEMC
FTSSGENTEPLPANSYVGEDGTSPLISCAHCCLQVHASCYGVRPELAKEGWTCSRCAAHA
WTAECCLCNLRGGALQRTTEHRWIHVICAIAVPEVRFLNVIERNPVDVSAIPEQRWKLKC
IYCRKRMKRVSGACIQCSYEHCSTSFHVTCAHAAGVLMEPDDWPYVVSITCLKHRASGAG
GQLLRTVSLGQIVITKNRNGLYYRCRVIGTTAQTFYEVNFDDGSYSDNLYPESITSRDCL
RLGPPPEGELVELRWTDGNLYRARFISMATSLIYQVEFEDGSQLTVKRGDIFTLEEELPK
RVRSRLSLSTGTPQEPSFSGDDVKAAKRPRVASVLATTTEDTGRSPEYLSFMESLLQAQG
RPGAPF
NT seq 3261 nt   +upstreamnt  +downstreamnt
atggggtccgaggaccacagcgcccagaaccccagctgtaagatcatgactttccgcccc
accatggatgaattcagggacttcaacagatatgtggcgtacattgagtcgcagggtgcc
caccgtgctggcctggccaagatcattccacccaaggagtggaagccacggcagacgtat
gatgacatcgacgatgtggtcatcccagcgcctattcagcaggtggtgacgggccagtcg
gggcttttcacacagtacaacatccagaagaaggccatgactgtgggggagtaccgccgc
ctagccaatagtgaaaagtactgtaccccacgccatcaggacttcgatgacttggagcgc
aagtactggaagaacctgacctttgtctcacccatctatggagctgacatcagtggctcc
ctgtacgacgatgacgtggcgcagtggaacatcggcaatctgaggaccatcctagacatg
gtggagcgcgaatgcgggaccatcattgagggcgtgaatacaccctacttgtactttggc
atgtggaagaccacgtttgcctggcacacagaggacatggacctctacagcatcaactac
ctgcacttcggcgagcctaagtcctggtacgccataccaccggagcacggcaagcgcctg
gagcgcctggccataggcttcttccctgggagctcacagggctgtgatgccttcctaagg
cacaagatgacactcatctcgcccatcatcctgaagaagtacggcatccccttcagccgg
attacacaggaagctggggagttcatgatcacgttcccctatggttaccatgcgggcttc
aaccatggctttaactgcgctgagtccactaacttcgccacactgcgctggatcgactat
ggcaaagtggccacacagtgtacatgtcgaaaggacatggtcaagatctccatggacgtg
tttgtacgcatcctgcagcccgaacgctatgagcaatggaagcaaggccgtgacctcaca
gtgctggaccacacgaggcccacagccctgagcagtcctgagctcagctcctggagtgcc
tcgcgcacctccatcaaggccaagctcctgcgcagacaaattagtgtgaaggagagcaga
ccctggagaaaggctgaggaggagaggaggcgggagccgaccaggaggccagggccggcg
tcacaccggagacggagccagcccaagaagtcaaaacctgaagagtccaggtctccaggg
gaagccacggctggggtatctactctggatgaggccaggggctgctcccgaggagaggcc
atgcctgaggacgaggaggaggaggagctgctaccttcacagggccatgaggccgagggt
gtggaagaggatggcagaggcaagcctcggcctactaaggccagaaataagaagaagact
cccagcccgtcgtcacccccgttgctgtctgccccaccagccctattccccaccgaggag
gtcctgaggccaccaccccaacccaagtctccagggccagctatgggccccatggctgca
gaggggggtcctccaccaacacccctcaatgtcgtgcctcctggggcgccagttgaggaa
gcagaggtgcggccacggcccattatcccaatgctgtacgtgttgccccgcaccagcagc
accgatggggacagggagcactctgcccacgcacagttggcacccatggagctggggcca
gaagaggaaaaccaggcccaggctggtgactcacagggaacaacccctttctctaagctg
aaggtggagatcaaaaagagccggcgtcaccccttgggtcggccacccactcgatccccg
ctgtctgtggtcaagcaggaggcctcaagtgatgaagaagccttcctgttctcaggagag
gatgatgtcactgatcctgaggccttgagatcgctgctgtccctgcagtggaagaacaag
gcggccagcttccaagccgagaggaagttcaatgcggcagccgccctcagtgagccctac
tgtgccatctgtaccctcttctacccctacagccagtcagtacagacagagcgggacagt
gctgtccagccgccctccaaaagtggccagaggacacggccactgatccctgagatgtgc
ttcacttcaagtggggagaacacagagccgctgcctgctaactcctacgtcggtgaggac
ggcaccagtccactcatctcctgtgcccactgctgcctgcaggtccatgccagttgctat
ggtgtccggcctgagttggccaaagagggctggacatgttcccggtgtgcggcccacgct
tggactgcggaatgctgtttgtgcaacctgcgggggggagcgctacagaggaccacagag
cacaggtggattcacgtgatctgcgccattgcagtccctgaggtacgattcctcaatgtg
attgaacgcaacccagtggacgtcagtgccatccctgagcagcgatggaaactgaaatgc
atttactgccgcaagcgtatgaagagagtgtcgggtgcctgcatccagtgctcctatgag
cactgctccacatccttccatgtgacctgtgcgcatgctgctggtgtcctcatggaaccc
gatgactggccctatgtggtgtccatcacctgcctcaagcaccgggccagcggagcaggg
ggccagctcctgcgcacagtgtccctgggccagatcgtcatcaccaagaaccgcaatggg
ctctactatcgctgccgggtcattggcaccactgcgcagacattctacgaggtcaacttt
gacgatggctcctacagtgacaacctgtacccagagagcatcacgagcagagactgccta
cggctagggccacctcctgagggcgagctggtggagcttcggtggacagacggtaatctg
tacagagccaggtttatctccatggccaccagcctcatctaccaggtagagtttgaggat
gggtctcagctgactgtgaagcgtggggacatcttcacactggaagaggagctgcccaag
agggtgcgttcccggctgtcactgagcactggcacaccacaggagcccagcttctctgga
gacgatgtgaaggctgccaagcgcccacgggtggcctcagtgctggccaccaccactgag
gacacagggcgtagcccagaatacctgtccttcatggagagcctgctgcaggcacagggc
cggcctggagcacccttctag

DBGET integrated database retrieval system