KEGG   Mus musculus (mouse): 19646
Entry
19646             CDS       T01002                                 

Symbol
Rbbp4, RBA, RBAP48, mRbAp48
Name
(RefSeq) retinoblastoma binding protein 4, chromatin remodeling factor
  KO
K10752  histone-binding protein RBBP4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    19646 (Rbbp4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    19646 (Rbbp4)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histone chaperones
    CAF-1
     19646 (Rbbp4)
  Histone modification proteins
   HAT complexes
    HATB complex
     19646 (Rbbp4)
   HDAC complexes
    Sin3A-HDAC complex
     19646 (Rbbp4)
   Polycomb group proteins
    PRC2-EZH1 complex
     19646 (Rbbp4)
    PRC2-EZH2 complex
     19646 (Rbbp4)
  Centromeric chromatin formation proteins
   Kinetochore proteins
    MIS16-MIS18 complex
     19646 (Rbbp4)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    19646 (Rbbp4)
  Chromatin remodeling factors
   NuRD complex
    19646 (Rbbp4)
   NuRF complex
    19646 (Rbbp4)
   NuRF complex (fruit fly)
    19646 (Rbbp4)
SSDB
Motif
Pfam: CAF1C_H4-bd WD40 eIF2A ANAPC4_WD40 Capsid_NCLDV
Other DBs
NCBI-GeneID: 19646
NCBI-ProteinID: NP_033056
MGI: 1194912
Ensembl: ENSMUSG00000057236
Vega: OTTMUSG00000009619
UniProt: Q60972
Position
4; 4 D2.2
AA seq 425 aa
MADKEAAFDDAVEERVINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGKD
FSIHRLVLGTHTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIK
INHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEG
YGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHE
SLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVAL
WDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSPEDAE
DGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYNDEDPEGSVDP
EGQGS
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggctgacaaggaagcggcctttgacgacgcagtggaagaacgggtgatcaacgaggag
tacaaaatatggaagaagaacaccccttttctttatgatttggtgatgacccatgccctg
gagtggcccagcttaactgcccagtggcttccagatgtgaccaggcctgaagggaaagat
ttcagcattcatcggcttgtcctgggaacacacacatctgatgaacagaaccacctggtg
attgccagtgtccagctccctaatgatgatgctcagtttgatgcatcccattatgacagt
gaaaaaggagaatttggaggttttggttctgtcagtgggaaaattgaaatagaaatcaag
atcaaccatgaaggagaagtgaacagggcccggtacatgcctcagaacccctgcatcatt
gcaacaaagactccatccagtgatgttcttgtttttgactacacaaagcacccttctaaa
ccagacccttctggagaatgcaaccccgatttgcgtctccgtggacatcagaaggaaggt
tatgggctttcttggaatccaaatctcagtgggcacttacttagtgcttcagatgaccat
accatctgcctgtgggacatcagtgcagttccaaaagaaggaaaggtggtggatgcaaag
accatcttcacggggcatacagcagtagtggaggacgtgtcctggcatctgctccacgag
tctctatttggctcagttgctgatgaccagaagcttatgatttgggacactcgttcaaac
aatacttccaagccaagccactcggttgatgctcacacagctgaagtgaattgcttatct
ttcaatccttatagtgagttcattcttgccacaggatcggctgacaagactgttgccttg
tgggatctgaggaatctgaaactcaagttgcactcctttgaatcccataaggatgaaata
ttccaagttcagtggtcacctcacaatgagactatcttagcttccagtggtaccgatcgt
aggctgaatgtctgggatctaagtaaaattggagaagagcagtccccagaagatgcagag
gatggcccaccagaattgttgtttattcatggtggtcacactgccaagatatctgacttc
tcctggaatcccaatgagccttgggtgatttgttctgtatcagaagacaatatcatgcaa
gtgtggcagatggcggagaacatttacaatgatgaagatcctgaaggaagtgtggatcca
gagggacaagggtcctag

DBGET integrated database retrieval system