KEGG   Mus musculus (mouse): 19687Help
Entry
19687             CDS       T01002                                 

Gene name
Rfc1, 140kDa, Alp145, RFC140, Recc1
Definition
(RefSeq) replication factor C (activator 1) 1
  KO
K10754  replication factor C subunit 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
mmu03420  Nucleotide excision repair
mmu03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    19687 (Rfc1)
   03420 Nucleotide excision repair
    19687 (Rfc1)
   03430 Mismatch repair
    19687 (Rfc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    19687 (Rfc1)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    19687 (Rfc1)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    19687 (Rfc1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     19687 (Rfc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RFC1 BRCT AAA PTCB-BRCT RuvB_N Rad17 AAA_16 AAA_22 AAA_33 BRCT_2 AAA_14 Zeta_toxin AAA_18 AAA_5 AAA_7 RNA_helicase NTPase_1 AAA_17 AAA_30
Motif
Other DBs
NCBI-GeneID: 19687
NCBI-ProteinID: NP_035388
MGI: 97891
Ensembl: ENSMUSG00000029191
Vega: OTTMUSG00000038036
UniProt: P35601 G3X8Z6
Position
5 C3.1; 5 33.61 cM
AA seq 1131 aa AA seqDB search
MDIRKFFGVISSGKKPVNETVKNEKTKASEGTVKGKKGVKEAKVNNSGKEDASKPKQHSK
KKRIINDSDSESEETVQVKNAKKKSEKLSLSYKPGKVSQKDPVTYVSETDEDDDFVCKKA
ASKSKENGVSTNSYLGTSNVKKNEENVKTKNKPLSPIKLTPTSVLDYFGTESVQRSGKKM
VTSKRKESSQNTEDSRLNDEAIAKQLQLDEDAELERQLHEDEEFARTLALLDEEPKIKKA
RKDSEEGEESFSSVQDDLSKAEKQKSPNKAELFSTARKTYSPAKHGKGRASEDAKQPCKS
AHRKEACSSPKASAKLALMKAKEESSYNETELLAARRKESATEPKGEKTTPKKTKVSPTK
RESVSPEDSEKKRTNYQAYRSYLNREGPKALGSKEIPKGAENCLEGLTFVITGVLESIER
DEAKSLIERYGGKVTGNVSKKTNYLVMGRDSGQSKSDKAAALGTKILDEDGLLDLIRTMP
GKRSKYEMAAEAEMKKEKSKLERTPQKNDQGKRKISPAKKESESKKCKLTLLKNSPMKAV
KKEASTCPRGLDVKETHGNRSSNKEECLLWVDKYKPASLKNIIGQQGDQSCANKLLRWLR
NWHKSSPEEKKHAAKFGKLASKDDGSSFKAALLSGPPGVGKTTTASLVCQELGYSYVELN
ASDTRSKNSLKAVVAESLNNTSIKGFYTSGAAPSVSARHALIMDEVDGMAGNEDRGGIQE
LIGLIKHTKIPIICMCNDRNHPKIRSLVHYCFDLRFQRPRVEQIKSAMLSIAFKEGLKIP
PPAMNEIILGANQDVRQVLHNLSMWCAQSKALTYDQAKADSQRAKKDIRLGPFDVTRKVF
AAGEETAHMSLMDKSDLFFHDYSIAPLFVQENYLHVKPVAAGGDMKKHLMLLSRAADSIC
DGDLVDNQIRSKQNWSLLPTQAIYASVLPGELMRGYMTQFPSFPSWLGKHSSTGKHDRIV
QDLSLHMSLRTYSSKRTVNMDYLSHIRDALVRPLTSQGVEGAQHVIKLMDTYYLMKEDFE
NIMEVSSWGGKPSAFSKLDPKVKAAFTRAYNKEAHLTPYSLQVVKTSRLSTGPALDSEYS
EEFQEDDTQSEKEQDAVETDAMIKKKTRSSKPSKSEREKESKKGKGKNWKK
NT seq 3396 nt NT seq  +upstreamnt  +downstreamnt
atggacattcggaaattctttggggttatatcaagtggaaaaaagcctgtaaacgagaca
gtaaagaatgagaagacaaaagcttcggagggaactgtcaaaggaaaaaagggagtcaag
gaggccaaggtcaataactccggtaaagaggacgcctccaaaccaaagcagcacagcaag
aagaagaggatcatcaatgactcagactcagagtcagaggagacagtacaggtaaaaaat
gctaaaaagaaatcagaaaaattgtcactgtcttataaacctggtaaagtctctcagaag
gatcctgtcacctacgtctctgagacagatgaagatgatgactttgtatgtaaaaaggca
gcctccaaatcaaaagagaatggagtatctacaaatagttaccttggaacatcaaacgtg
aaaaaaaatgaagaaaacgttaagactaagaacaagccgttatctccaataaaactcaca
ccaacgtcagtgctcgactattttggaactgaaagtgtccagagatctgggaagaagatg
gtgacaagcaaaaggaaagaatcttctcaaaacacagaggattccagattaaatgatgag
gccatcgccaagcagctgcagctggatgaagatgcagagctggagaggcagttgcatgaa
gatgaagaatttgcaagaacactggccttattggatgaagaacccaagatcaaaaaggcc
cgaaaggattctgaagagggagaagaatcattttcatctgtccaagatgatttaagcaaa
gcagaaaagcagaaaagccctaataaagccgagcttttctcaactgcaagaaagacctac
agtcctgctaagcatggcaaggggagggcttcagaagatgctaagcagccttgcaaatca
gctcaccggaaggaagcctgttcctcacccaaggccagtgccaaactggcgcttatgaaa
gcaaaagaagaaagttcttacaacgaaacagagctgctggctgcaagaagaaaagaaagc
gccactgaacccaaaggagagaaaacaactcctaagaaaacgaaagtttctccaactaag
agagagtctgtaagcccagaagactctgaaaagaagcgcactaattatcaagcttatcga
agctacttgaaccgagaaggtcccaaagctctgggctccaaagaaatacccaagggagct
gaaaattgcttggaaggcctgacgtttgtgatcacaggagtgctggagtccattgaacga
gacgaagccaagtctctaattgaacgttatggggggaaagtaacaggaaacgtgagcaag
aaaaccaactacctcgtcatgggccgcgacagtgggcagtccaagagtgacaaggcagca
gctctgggaacaaaaatcctcgatgaagacggcctgttggatctgattcgaactatgcca
ggcaagagatccaagtatgagatggctgctgaggctgagatgaagaaagaaaagtccaaa
ttggagcgaacaccccaaaaaaatgatcaaggaaaaagaaaaattagtccagccaagaag
gagtcagagtctaaaaagtgcaagctgactctcctaaagaacagtcctatgaaggcagtg
aagaaggaggcaagcacgtgcccaaggggcctggatgtcaaggagacacatggcaaccgc
agtagcaacaaagaggaatgtctgctctgggtggataagtacaagcccgcctcactcaag
aacataatcggacagcagggtgaccagagctgtgccaacaaattactacgttggctcaga
aactggcacaagagttctcctgaagagaaaaaacatgcagcaaagtttggcaaacttgcc
agcaaagatgatggctccagtttcaaggcagctctgctgtctggccctccaggtgttggc
aaaaccactacagcttctcttgtgtgtcaggaattgggctacagttatgtggaactaaat
gcaagtgatactcggagtaagaacagtttgaaagcagttgttgctgaatccttgaacaac
accagcatcaaaggcttttatacaagtggagcggctccttccgtgagtgcgaggcacgcc
ctcatcatggatgaggtcgatggcatggcaggcaatgaagacaggggtggaattcaggag
ctaataggcctgataaagcatactaaaattcccatcatttgtatgtgcaatgatagaaac
caccccaaaattcgctcattggttcattattgttttgatcttcgtttccaaagacctcga
gttgaacagattaagagtgcaatgctgtctattgcatttaaagagggtttaaaaatcccc
cctccagctatgaatgaaataattttgggagctaatcaagatgtcagacaggttttacac
aatctcagtatgtggtgtgcacaaagtaaggccctgacctatgaccaagccaaggctgat
tctcagagggctaagaaggatatcagactgggcccatttgatgtcactcggaaagtgttt
gcagctggagaggagactgcacacatgtcactgatggacaagtcagatctcttcttccat
gactattccatagcacccctctttgtccaggagaactacctgcatgtaaagcctgtggct
gcaggaggtgacatgaaaaagcacttgatgcttttaagccgggcagcagatagcatatgt
gacggtgacttagtggacaatcagatccggagtaagcaaaactggagtcttctgcccacc
caggccatctatgccagtgttcttcctggagagttgatgcggggctacatgactcagttt
ccgagcttcccgagctggctggggaagcactcgtctacgggcaaacatgatcggattgtt
caggacctatccttgcacatgagtcttagaacttactccagcaaaaggacagtgaacatg
gattacctgtcacacatcagagacgcacttgtacgacccttgacctcacaaggggtagaa
ggggctcagcatgtcatcaaacttatggacacatactatctgatgaaagaagattttgag
aacatcatggaagttagcagctgggggggcaagcccagtgccttttccaagctggatccc
aaggtgaaagcggccttcacaagagcctacaataaggaggcccacctgaccccatactca
cttcaggtagtaaagacatcgaggctcagcacgggtccagcactggattctgagtacagt
gaggagttccaggaagatgacactcagtctgagaaagagcaggatgcagtggagactgac
gccatgatcaagaaaaagacaagatcttcaaaaccttcaaagtcagaaagagagaaggag
tccaaaaaaggaaaaggaaagaattggaagaaatga

DBGET integrated database retrieval system