KEGG   Mus musculus (mouse): 19720
Entry
19720             CDS       T01002                                 

Gene name
Trim27, AW538890, Gm19403, Rfp
Definition
(RefSeq) tripartite motif-containing 27
  KO
K12009  tripartite motif-containing protein 27 [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    19720 (Trim27)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     19720 (Trim27)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRIM/RBCC proteins
    19720 (Trim27)
SSDB
Motif
Pfam: PRY SPRY zf-B_box zf-C3HC4_4 zf-C3HC4 zf-RING_UBOX zf-C3HC4_3 zf-C3HC4_2 zf-RING_2 zf-RING_5 zf-RING_4 Baculo_IE-1
Other DBs
NCBI-GeneID: 19720
NCBI-ProteinID: NP_033080
MGI: 97904
Ensembl: ENSMUSG00000021326
Vega: OTTMUSG00000032925
UniProt: Q62158
Position
13 A2; 13 7.67 cM
AA seq 513 aa
MASGSVAECLQQETTCPVCLQYFVEPMMLDCGHNICCACLARCWGAAETNVSCPQCRETF
PQRHMRPNRHLANVTQLVKQLRTERPSGPGGEMGVCEKHREPLKLYCEQDQMPICVVCDR
SREHRGHSVLPLEEAVEGFKEQIQNRLDHLRRVKDLKKRRRAQGEQARAELLSLTQMERE
KIVWEFEQLYHSLKEHEYRLLARLEELDLAIYNSINGAITQFSCNISHLSGLIAQLEEKQ
QQPTRELLQDIGDTLSRAERIRIPEPWITPPDLQEKIHIFAQKCLFLTESLKQFTEKMQS
DMEKIQELREAQLYSVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCV
LGSPCFIAGRHYWEVEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWAL
TSPMTALPLRTPLQRVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFSLSYSG
GKSAAPLIICPMSGIDGFSGHVGNHGHSMETSP
NT seq 1542 nt   +upstreamnt  +downstreamnt
atggcctccgggagcgtggccgagtgcctgcagcaggagaccacctgccccgtgtgcctt
cagtacttcgtggagcctatgatgctcgactgcggccacaacatctgttgcgcgtgcctg
gcccgctgctggggtgccgcggagactaacgtgtcgtgtccgcagtgccgggagaccttc
ccgcagcgccacatgcgacccaaccggcacctggccaacgtgacccagctggtgaagcag
ctgcgcaccgagcggccgtcggggcccggcggcgagatgggcgtgtgcgagaagcaccgg
gagcctctgaagctgtactgcgagcaggaccagatgcccatctgcgtggtgtgcgaccgc
tcgcgcgagcaccgcggccacagcgtgctgcccctggaggaggcggtggagggcttcaag
gagcaaatccagaaccgactggaccacctaagaagagtgaaagacttgaagaagagacgg
cgggcacagggggagcaggcccgagctgagcttttgagcctgactcagatggagagggaa
aaaattgtctgggagtttgagcagctctatcactcgttgaaggagcatgagtaccgcctg
ttggctcgccttgaggagctcgacttggccatctataacagcatcaacggggccatcact
cagttctcctgcaacatctcccacctcagtggcctgattgcccaactggaagagaagcag
cagcagcccacgcgggagctcttacaggacattggagacacactgagcagggctgaaaga
atcaggatccctgagccctggatcacacccccagatctacaagagaaaatccatattttt
gcccaaaaatgtctgtttttgacagaaagtctaaaacagttcacagaaaagatgcagtca
gatatggagaagatccaagagttgagagaggctcagttatactcagttgatgtaaccctg
gacccagacacagcctatcccagtctgattctttctgataatcttcggcaagtacggtac
agttacctccagcaggatcttccagacaaccctgagcgattcaatctgtttccctgtgtc
ttgggctctccatgtttcatcgctgggagacattactgggaggtagaggtgggagataaa
gccaagtggaccataggtgtctgtgaagactcggtgtgcagaaaaggtggggtgacctca
gccccccagaatggattctgggcagtgtcattgtggtatgggaaagaatattgggctctt
acatccccaatgactgcactacccctgcggacccctctccagagagtagggattttcttg
gactatgatgctggtgaggtttccttctacaatgtgacagagagatgccatacctttact
ttctctcacgctaccttctgtgggccagtccggccctacttcagcctaagctactcggga
gggaagagcgcagctcctttgatcatctgccctatgagtgggattgatgggttttctggc
catgttgggaatcatggtcattccatggagacctctccgtga

DBGET integrated database retrieval system