KEGG   Mus musculus (mouse): 20182Help
Entry
20182             CDS       T01002                                 

Gene name
Rxrb, AL023085, H-2RIIBP, Nr2b2, RCoR-1, Rub
Definition
(RefSeq) retinoid X receptor beta
  KO
K08525  retinoid X receptor beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03320  PPAR signaling pathway
mmu04659  Th17 cell differentiation
mmu04919  Thyroid hormone signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05216  Thyroid cancer
mmu05222  Small cell lung cancer
mmu05223  Non-small cell lung cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    20182 (Rxrb)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    20182 (Rxrb)
   03320 PPAR signaling pathway
    20182 (Rxrb)
   04919 Thyroid hormone signaling pathway
    20182 (Rxrb)
   04928 Parathyroid hormone synthesis, secretion and action
    20182 (Rxrb)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    20182 (Rxrb)
   05202 Transcriptional misregulation in cancer
    20182 (Rxrb)
  09162 Cancer: specific types
   05226 Gastric cancer
    20182 (Rxrb)
   05216 Thyroid cancer
    20182 (Rxrb)
   05222 Small cell lung cancer
    20182 (Rxrb)
   05223 Non-small cell lung cancer
    20182 (Rxrb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    20182 (Rxrb)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mmu03310]
    20182 (Rxrb)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    20182 (Rxrb)
Nuclear receptors [BR:mmu03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   20182 (Rxrb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_recep zf-C4 Nuc_recep-AF1
Motif
Other DBs
NCBI-GeneID: 20182
NCBI-ProteinID: NP_035436
MGI: 98215
Ensembl: ENSMUSG00000039656
Vega: OTTMUSG00000037107
UniProt: P28704
Position
17 B1; 17 17.98 cM
AA seq 520 aa AA seqDB search
MSWATRPPFLPPRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAAAAAAAGEQQALEP
EPGEAGRDGMGDSGRDSRSPDSSSPNPLSQGIRPSSPPGPPLTPSAPPPPMPPPPLGSPF
PVISSSMGSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPP
PPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYSCRDNKDCTVDKRQ
RNRCQYCRYQKCLATGMKREAVQEERQRGKDKDGDGDGAGGAPEEMPVDRILEAELAVEQ
KSDQGVEGPGATGGGGSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSSLPLDDQVILLR
AGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMRM
DKTELGCLRAIILFNPDAKGLSNPGEVEILREKVYASLETYCKQKYPEQQGRFAKLLLRL
PALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgggccactcgtccgcccttcctcccgccgcggcatgccgcggggcagtgtggg
ccggtgggggtgagaaaagagatgcattgtggggtcgcgtcccggtggcggcggcggcgg
ccctggctggatcccgcggcggcggcggcggcggccggagagcagcaagccctggagccg
gagccgggggaggctggccgggacgggatgggcgacagcgggcgggattcccgaagccca
gacagctcctccccaaatcccctttctcaggggatccgtccgtcttctcctcctggccca
cctcttaccccttcagcacctccacctccaatgccacccccgccactgggctcccccttc
ccagtcatcagttcttccatggggtcccctggtctgccccctccggctcccccaggattc
tccgggcctgtcagcagccctcagatcaactccacagtgtcgctccctgggggtgggtct
ggcccccctgaagatgtgaagccaccggtcttaggggtccggggcctgcactgtccaccc
cctccaggtggtcctggggctggcaaacggctctgtgcaatctgcggggaccgaagctca
ggcaagcactatggggtttacagctgcgagggctgcaagggtttcttcaagcgcaccatt
cggaaggacctgacctactcgtgtcgtgataacaaagactgtacagtggacaagcgccag
cggaatcgctgtcagtactgtcgctatcagaagtgcctggccactggcatgaaaagggag
gcggttcaggaggagcgtcaacgggggaaggacaaagacggggatggagatggggctggg
ggagcccctgaggagatgcctgtggacaggatcctggaggcagagcttgctgtggagcag
aagagtgaccaaggcgttgagggtcctggggccaccgggggtggtggcagcagcccaaat
gacccagtgactaacatctgccaggcagctgacaaacagctgttcacactcgttgagtgg
gcaaagaggatcccgcacttctcctccctacctctggacgatcaggtcatactgctgcgg
gcaggctggaacgagctcctcattgcgtccttctcccatcggtccattgatgtccgagat
ggcatcctcctggccacgggtcttcatgtgcacagaaactcagcccattccgcaggcgtg
ggagccatctttgatcgggtgctgacagagctagtgtccaaaatgcgtgacatgaggatg
gacaagacagagcttggctgcctgcgggcaatcatactgtttaatccagacgccaagggc
ctctccaaccctggagaggtggagatccttcgggagaaggtgtacgcctcactggagacc
tattgcaagcagaagtaccctgagcagcagggccggtttgccaagctgctgttacgtctt
cctgccctccgctccatcggcctcaagtgtctggagcacctgttcttcttcaagctcatt
ggcgacacccccattgacaccttcctcatggagatgcttgaggctccccaccagctagcc
tga

DBGET integrated database retrieval system