KEGG   Mus musculus (house mouse): 20411
Entry
20411             CDS       T01002                                 
Symbol
Sorbs1, 2310065E01Rik, 9530001P15Rik, CAP, SH3P12, Sh3d5, mKIAA1296
Name
(RefSeq) sorbin and SH3 domain containing 1
  KO
K06086  sorbin and SH3 domain containing protein 1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03320  PPAR signaling pathway
mmu04520  Adherens junction
mmu04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    20411 (Sorbs1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    20411 (Sorbs1)
   03320 PPAR signaling pathway
    20411 (Sorbs1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    20411 (Sorbs1)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   20411 (Sorbs1)
SSDB
Motif
Pfam: SH3_9 SH3_1 SH3_2 Sorb
Other DBs
NCBI-GeneID: 20411
NCBI-ProteinID: NP_001030136
MGI: 700014
Ensembl: ENSMUSG00000025006
UniProt: Q62417 E9QNA7
Position
19:complement(40280484..40502399)
AA seq 740 aa
MSSECDVGSSKAVVNGLASGNHGPDKDMDPTKICTGKGTVTLRASSSYRGTPSSSPVSPQ
ESPKHESKSDEWKLSSSADTNGNAQPSPLAAKGYRSVHPSLSADKPQGSPLLNEVSSSHI
ETDSQDFPPTSRPSSAYPSTTIVNPTIVLLQHNREQQKRLSSLSDPASERRAGEQDPVPT
PAELTSPGRASERRAKDASRRVVRSTQDLSDVSTDEVGIPLRNTERSKDWYKTMFKQIHK
LNRDDDSDVHSPRYSFSDDTKSPLSVPRSKSEMNYIEGEKVVKRSATLPLPARSSSLKSS
PERNDWEPPDKKVDTRKYRAEPKSIYEYQPGKSSVLTNEKMSSAVSPTPDITSEPPGYIY
SSNFHAVKRESDGTPGGLASLENERQIYKSVLEGGDIPLQGLSGLKRPSSSASTKDSESP
RHFIPADYLESTEEFIRRRHDDKEKLLADQRRLKREQEEADIAARRHTGVIPTHHQFITN
ERFGDLLNIDDTAKRKSGLEMRPARAKFDFKAQTLKELPLQKGDVVYIYRQIDQNWYEGE
HHGRVGIFPRTYIELLPPAEKAQPRKLAPVQVLEYGEAIAKFNFNGDTQVEMSFRKGERI
TLLRQVDENWYEGRIPGTSRQGIFPITYVDVLKRPLVKTPVDYIDLPYSSSPSRSATVSP
QQPQAQQRRVTPDRSQPSLDLCSYQALYSYVPQNDDELELRDGDIVDVMEKCDDGWFVGT
SRRTRQFGTFPGNYVKPLYL
NT seq 2223 nt   +upstreamnt  +downstreamnt
atgagttctgaatgtgatgttggaagctctaaagctgtggtgaatggcttggcatctggc
aaccatggaccagacaaagacatggaccctaccaaaatctgcactgggaaaggaacagtg
actcttcgggcctcgtcttcctacaggggaaccccaagcagcagccctgtgagcccccag
gaatctccgaagcatgaaagcaagtcagatgaatggaaactttcttccagtgcagatacc
aatggcaacgcccagccctccccacttgctgccaagggctatagaagtgtgcatcccagc
ctttctgctgacaagccccagggcagtcctttactaaacgaagtttcttcttcccacatt
gaaaccgattcccaagacttccctccaacaagcagaccttcgtctgcctacccctccacc
accatcgtcaaccctaccattgtgctcctgcagcacaatcgagagcagcaaaagcgactc
agtagtctttcagatcctgcctcagagagaagagcgggtgagcaggacccagtaccaacc
ccagcagaactcacttcgcccggcagggcttctgagagaagggcaaaggatgctagcaga
cgggtggtgaggagcacacaggacctgagcgatgtgtctacagatgaagtgggcatccca
ctccggaataccgagcgatcgaaagactggtacaaaactatgtttaaacagatccacaaa
ctgaacagagatgatgattctgatgtccattcccctcgatattccttctctgacgacaca
aagtctcccctttctgtgcctcgctcaaaaagtgagatgaactacatcgaaggggagaaa
gtggttaagaggtccgccacactcccgctcccagcccgctcctcctcactcaagtccagc
ccggaaagaaacgactgggagcccccagataagaaagtggatacgagaaaataccgagca
gagcccaaaagcatttacgaatatcagccgggcaagtcttcggtcctgaccaatgagaag
atgagctcagcagtcagcccgactccagacattacgtcagagcctcctggatatatctat
tcttccaacttccatgcagtgaagagagaatcggacgggacccccgggggtctcgctagc
ttggagaatgagaggcagatctataagagtgtcttggaaggtggcgacatccctcttcag
ggcctcagtgggctcaagcgaccttccagctcagcttccactaaagattcagagtcacca
agacattttataccagctgattacttggagtccacagaagaatttattcggagacggcac
gatgataaagagaaacttttagcggaccagagacgacttaagcgcgagcaagaagaggcc
gatattgcagctcgccgccacacaggtgtcatcccgactcatcatcagtttatcactaat
gagcgctttggggacctcctcaatatagatgatacggccaaaaggaaatctgggttagag
atgagacctgctcgagccaaatttgactttaaagcccagaccctgaaggagctgcctctg
cagaagggagacgttgtttacatctacagacagattgaccagaactggtatgaaggtgaa
caccatggccgggtgggaatcttcccacgcacctatatcgagcttcttcctccagctgag
aaggctcagcccagaaagttggcacccgtacaagttttggaatatggagaagccattgcg
aagtttaactttaatggagatacacaagtagaaatgtctttccgaaagggggagaggatc
acgctgctccgacaggtggatgagaactggtacgaagggaggattcctgggacatctcgc
caaggcattttccctatcacctatgtagatgtgcttaagaggccattggtgaaaacccct
gtggattacatcgacctgccttattcttcttccccaagtcgcagtgccactgtgagccca
cagcaacctcaagcccagcagcgaagagtcaccccagacaggagtcagccctcactggat
ttgtgtagctaccaagcgttatatagttatgtgccacagaacgatgatgagttggaactc
cgagatggagatattgttgatgtcatggaaaaatgtgacgatggatggtttgttggcact
tcgagaaggacgaggcagtttggtacttttccaggcaactatgtaaaacctttatatcta
taa

DBGET integrated database retrieval system