KEGG   Mus musculus (mouse): 20440
Entry
20440             CDS       T01002                                 

Gene name
St6gal1, AW742324, Si, Siat1, St6G, St6Gal-I, St6gal, St6galI
Definition
(RefSeq) beta galactoside alpha 2,6 sialyltransferase 1
  KO
K00778  beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00510  N-Glycan biosynthesis
mmu00514  Other types of O-glycan biosynthesis
mmu01100  Metabolic pathways
Module
mmu_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    20440 (St6gal1)
   00514 Other types of O-glycan biosynthesis
    20440 (St6gal1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    20440 (St6gal1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-(2,6)-sialyltransferase
     20440 (St6gal1)
Glycosyltransferases [BR:mmu01003]
 Terminal extension
  Sialyltransferase
   20440 (St6gal1)
SSDB
Motif
Pfam: Glyco_transf_29
Other DBs
NCBI-GeneID: 20440
NCBI-ProteinID: NP_001239434
MGI: 108470
Ensembl: ENSMUSG00000022885
Vega: OTTMUSG00000025920
UniProt: Q64685 Q8BM62
Position
16 B1; 16 14.03 cM
AA seq 403 aa
MIHTNLKRKFSCFVLVFLLFAIICVWKKGSDYEALTLQAKVFQMPKSQEKVAVGPAPQAV
FSNSKQDPKEGVQILSYPRVTAKVKPQPSLQVWDKDSTYSKLNPRLLKIWRNYLNMNKYK
VSYKGPGPGVKFSVEALRCHLRDHVNVSMIEATDFPFNTTEWEGYLPKENFRTKAGPWHK
CAVVSSAGSLKNSQLGREIDNHDAVLRFNGAPTDNFQQDVGTKTTIRLVNSQLVTTEKRF
LKDSLYTEGILILWDPSVYHADIPQWYQKPDYNFFETYKSYRRLHPSQPFYILKPQMPWE
LWDIIQEISPDLIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYHQKFFDSA
CTMGAYHPLLFEKNMVKHLNEGTDEDIYLFGKATLSGFRNNRC
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgattcataccaacttgaagagaaagttcagctgctttgtcctggtctttctcctgttt
gccatcatctgcgtgtggaagaaagggagcgactatgaggctcttacattgcaagccaag
gtattccagatgccgaagagccaggagaaagtggccgtggggcctgctccccaggctgtg
ttctcaaacagcaaacaagaccctaaggaaggcgttcagatcctcagttaccccagggtc
acagccaaggtcaagccacagccctccttgcaggtgtgggacaaggactccacatactca
aaacttaaccccaggctgctgaagatctggaggaactatctgaacatgaataaatataaa
gtgtcctacaaggggccgggaccaggagtcaagttcagcgtagaggcgctgcgctgccac
cttcgagaccacgtgaatgtgtctatgatagaggccacagattttcccttcaacaccact
gaatgggagggttacctgcccaaggagaacttcagaaccaaggctgggccttggcataag
tgtgccgtcgtgtcttctgcaggatctctgaagaactcccagctgggtcgagagattgat
aatcatgatgcggtcctgaggtttaatggggcacctacagacaacttccaacaggatgtg
ggcacaaaaactaccatccgcctagtgaactctcagttagtcaccacagaaaagcgcttc
ctgaaggacagtttgtacaccgaaggaatcctgattctgtgggacccatctgtgtatcat
gcagacattccgcagtggtatcagaagccagactacaacttcttcgaaacctataagagt
taccgaaggcttcaccccagccagcctttttacatcctcaagccccagatgccatgggaa
ctatgggacatcattcaggaaatctctccagatctgattcagccgaatcccccatcctcc
ggcatgctgggtatcatcattatgatgacgctgtgtgaccaagttgatatttacgagttc
ctcccatccaagcgcaagacagatgtgtgctactatcaccagaagttctttgacagcgcc
tgcacgatgggtgcctaccatccgctcctcttcgagaagaatatggtgaagcatctcaat
gagggaacagatgaagacatttatttgtttgggaaagctaccctgtctggcttccggaac
aatcgctgttga

DBGET integrated database retrieval system