KEGG   Mus musculus (mouse): 20459
Entry
20459             CDS       T01002                                 

Symbol
Ptk6, BRK, Sik, Tksk, tks
Name
(RefSeq) PTK6 protein tyrosine kinase 6
  KO
K08894  protein tyrosine kinase 6 [EC:2.7.10.2]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    20459 (Ptk6)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     20459 (Ptk6)
Protein kinases [BR:mmu01001]
 Non-receptor tyrosine kinases
  SRC family
   20459 (Ptk6)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 Kdo Tfb2_C Haspin_kinase
Other DBs
NCBI-GeneID: 20459
NCBI-ProteinID: NP_033210
MGI: 99683
Ensembl: ENSMUSG00000038751
Vega: OTTMUSG00000016561
UniProt: Q64434 Q05AA8
Position
2:complement(180836917..180845408)
AA seq 451 aa
MVSWDKAHLGPKYVGLWDFKARTDEELSFQAGDLLHVTKKEELWWWATLLDAEGKALAEG
YVPHNYLAEKETVESEPWFFGCISRSEAMHRLQAEDNSKGAFLIRVSQKPGADYVLSVRD
AQAVRHYRIWKNNEGRLHLNEAVSFSNLSELVDYHKTQSLSHGLQLSMPCWKHKTEPLPH
WDDWERPREEFTLCKKLGAGYFGEVFEALWKGQVHVAVKVISRDNLLHQHTFQAEIQAMK
KLRHKHILSLYAVATAGDPVYIITELMPKGNLLQLLRDSDEKALPILELVDFASQVAEGM
CYLESQNYIHRDLAARNVLVTENNLCKVGDFGLARLVKEDIYLSHEHNVPYKWTAPEALS
RGHYSIKSDVWSFGVLLHEIFSRGQMPYPGMSNHETFLRVDAGYRMPCPLECPPNIHKLM
LSCWSRDPKQRPCFKDLCEKLTGITRYENLV
NT seq 1356 nt   +upstreamnt  +downstreamnt
atggtgtcttgggacaaggctcacctgggtcctaagtatgtgggcctctgggacttcaag
gcacggacagatgaggagctgagctttcaggcaggagacctcctccatgttaccaagaag
gaggaactgtggtggtgggccaccctgctggatgcagaaggcaaggccttggctgagggc
tatgtgcctcacaactacctggctgagaaggaaactgtggagtctgaaccgtggttcttt
ggttgcatctcccgctcagaggccatgcacaggctgcaggctgaggacaactcgaagggt
gccttcctgatcagagtcagccagaagccaggagcagactatgtcctctctgtccgggat
gctcaggccgtgcgacattacaggatctggaagaacaacgagggccggctgcacctgaat
gaggcggtatccttctccaatctgtctgagcttgtggactaccataagacccagagcctg
tctcatggcctacagctgtccatgccctgctggaagcacaaaactgagcccttgccccac
tgggatgactgggagaggccgagggaggagttcacactctgtaagaagctgggggccggc
tactttggggaggtctttgaagcgctctggaaaggccaggtccatgtggctgtgaaggtg
atctctagagacaatctcctgcaccagcacaccttccaggctgagattcaggccatgaag
aagctgcggcacaagcacatcctgtcactgtacgctgtggcgactgcaggggacccggtc
tacatcatcacggagctcatgcccaaggggaacctgctgcagctactgcgtgactctgat
gagaaagccctgcctattttggagctggtggactttgcatcacaggttgctgagggcatg
tgctacctggaatctcagaattacatccaccgtgacctggctgcaaggaacgttcttgtt
acagagaacaatctctgcaaagtgggggactttgggcttgccaggcttgtcaaggaggac
atctacctttcccatgagcacaatgtcccctacaaatggacagcacctgaggcactttcc
cgagggcattactccatcaagtctgatgtctggtcttttggagttcttcttcatgaaatt
ttcagcagggggcagatgccctacccaggcatgtccaatcatgaaaccttcctgagggtg
gatgccggctaccgcatgccctgccctctggagtgcccacccaacatacacaagctgatg
ctcagctgctggagcagagaccccaagcagagaccttgcttcaaagacctgtgtgagaaa
ctcacaggtatcaccaggtatgagaacctggtctga

DBGET integrated database retrieval system