KEGG   Mus musculus (mouse): 20591
Entry
20591             CDS       T01002                                 

Symbol
Kdm5c, D930009K15Rik, Jarid1c, Smcx, mKIAA0234
Name
(RefSeq) lysine (K)-specific demethylase 5C
  KO
K11446  [histone H3]-trimethyl-L-lysine4 demethylase [EC:1.14.11.67]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    20591 (Kdm5c)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    20591 (Kdm5c)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.67  [histone H3]-trimethyl-L-lysine4 demethylase
     20591 (Kdm5c)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     20591 (Kdm5c)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   Histone demethylases
    20591 (Kdm5c)
SSDB
Motif
Pfam: PLU-1 JmjC JmjN ARID PHD zf-C5HC2
Other DBs
NCBI-GeneID: 20591
NCBI-ProteinID: NP_038696
MGI: 99781
Ensembl: ENSMUSG00000025332
Vega: OTTMUSG00000017219
UniProt: P41230
Position
X:151015698..151062098
AA seq 1551 aa
MELGSDDFLPPPECPVFEPSWAEFRDPLGYIAKIRPIAEKSGICKIRPPADWQPPFAVEV
DNFRFTPRIQRLNELEAQTRVKLNYLDQIAKFWEIQGSSLKIPNVERRILDLYSLSKIVV
EEGGYETICKDRRWARVAQRLNYPPGKNIGSLLRSHYERIVYPYEMYQSGANLVQCNTRP
FDNEEKDKEYKPHSIPLRQSVQPSKFNSYGRRAKRLQPDPEPTEEDIEKNPELKKLQIYG
AGPKMMGLGLMAKDKTLRKKDKEGPECPPTVVVKEELGGDVKMESTSPKTFLEGKEELSH
SPEPCTKMTMRLRRNHSNAQFIESYVCRMCSRGDEDDKLLLCDGCDDNYHIFCLLPPLPE
IPKGVWRCPKCVMAECKRPPEAFGFEQATREYTLQSFGEMADSFKADYFNMPVHMVPTEL
VEKEFWRLVNSIEEDVTVEYGADIHSKEFGSGFPVSDSKRHLTPEEEEYATSGWNLNVMP
VLEQSVLCHINADISGMKVPWLYVGMVFSAFCWHIEDHWSYSINYLHWGEPKTWYGVPSL
AAEHLEEVMKKLTPELFDSQPDLLHQLVTLMNPNTLMSHGVPVVRTNQCAGEFVITFPRA
YHSGFNQGYNFAEAVNFCTADWLPAGRQCIEHYRRLRRYCVFSHEELICKMAACPEKLDL
NLAAAVHKEMFIMVQEERRLRKALLEKGITEAEREAFELLPDDERQCIKCKTTCFLSALA
CYDCPDGLVCLSHINDLCKCSSSRQYLRYRYTLDELPAMLHKLKVRAESFDTWANKVRVA
LEVEDGRKRSLEELRALESEARERRFPNSELLQRLKNCLSEAEACVSRALGLVSGQEAGP
DRVAGLQMTLAELRDFLGQMNNLPCAMHQIGDVKGILEQVEAYQTEAREALVSQPSSPGL
LQSLLERGQQLGVEVPEAQQLQRQVEQARWLDEVKRTLAPSARRGTLAIMRGLLVAGASV
APSPAVDKAQAELQELLTIAERWEEKAHLCLEARQKHPPATLEAIIHEAENIPVHLPNIQ
SLKEALAKARAWIADVDEIQNGDHYPCLDDLEGLVAVGRDLPVGLEELRQLELQVLTAHS
WREKASKTFLKKNSCYTLLEVLCPCADAGSDSTKRSRWMEKELGLYKSDTELLGLSAQDL
RDPGSVIVAFKEGEQKEKEGILQLRRTNSAKPSPLALLTTASSTASICVCGQVPAGVGAL
QCDLCQDWFHGRCVTVPRLLSSQRSSLPSSPLLAWWEWDTKFLCPLCMRSRRPRLETILA
LLVALQRLPVRLPEGEALQCLTERAISWQGRARQVLASEEVTALLGRLAELRQRLQAESK
PEESLAYPSDGGEGTGNMPKVQGLLENGDSVTSPEKVATEEGSDLELLSSILPQLSGPVL
ELPEATRAPLEELMMEGDLLEVTLDENHSIWQLLQAGQPPDLKRVQTLLELEKAERHGSR
TRGRALERRRRRKVDRGGEPDDPAREELEPKRVRSSGPEAEEVQEEEELEEETGGEVPPV
PFPNSGSPSIQEDQDGLEPVLEAGSDTSAPFSTLTSRLLMSCPQQPSLQQL
NT seq 4656 nt   +upstreamnt  +downstreamnt
atggagctggggtccgacgatttcctaccgccgccggagtgtccggtgttcgagcctagc
tgggccgagttccgagaccctcttggctacatcgcgaaaatcagacccatcgccgagaag
tccggcatttgcaagatccgcccacccgcggactggcagccaccctttgccgtggaagtg
gataacttcaggtttactccccgaatccagaggttgaatgagctggaggcccagacaaga
gtgaaactgaactatttggaccagattgccaaattctgggagatccagggctcatcctta
aagattcccaatgtagaacggcggatcttggacctctatagcctcagcaaaattgtggtg
gaagaaggtggttatgaaactatctgcaaggaccgtcgatgggcccgtgtggcccagcgt
ctcaactacccacctggcaaaaacattggttccttgctacgctctcactatgaacgcatt
gtttatccctatgaaatgtaccagtctggagccaaccttgtgcagtgtaacacacgccca
tttgataatgaggaaaaggacaaggaatataaaccccacagcatcccccttcgacagtct
gtgcagccttccaagttcaacagttatggacgacgggcaaagagactacagcctgatccg
gaacccacagaggaagacattgaaaagaatccagaactgaagaaattacagatatatgga
gcaggccccaagatgatggggctgggcctaatggccaaagataagactctgcggaaaaaa
gataaagaagggcctgagtgtccccccactgtggtggtaaaggaggaattaggtggggat
gtcaagatggaatcaacctcacccaagaccttcctagaaggcaaggaggaactgagtcat
agccctgagccctgcaccaagatgaccatgaggcttcgaaggaaccacagcaatgcccag
tttattgagtcatacgtatgccgaatgtgttcccgaggagatgaagatgacaaactctta
ctgtgtgatggctgtgatgacaattaccacatcttttgcctgctgcctcctttgcctgaa
atcccgaaaggtgtctggaggtgtccaaagtgtgtcatggcggagtgtaagcggccccct
gaagcctttggctttgagcaagctacccgggaatatactctgcagagctttggagagatg
gctgactcctttaaagctgactacttcaacatgcctgtgcatatggtacccacagaactt
gtagagaaggagttttggcggctggtgaatagcatcgaggaagacgtaactgtggagtat
ggggctgacatccattccaaagaatttggcagcggtttccctgtcagtgacagtaagcgg
cacctaaccccagaggaggaggagtatgctacaagtggttggaacctgaatgtgatgcct
gtattggagcagtctgtactgtgccacatcaatgcagatatatctggcatgaaggtaccg
tggctgtatgtgggaatggtcttctcagccttttgctggcatattgaagatcactggagt
tactctattaactacctccactggggtgagccaaaaacctggtatggagtcccatcgctt
gcagcggaacacttggaagaagtgatgaagaagctgacacctgagctttttgatagccag
cctgatctccttcaccaactcgtcaccctcatgaatcctaacacgctcatgtcccatggt
gtgccggttgtccgcacaaaccagtgtgcaggagaatttgtcatcacttttcctcgtgct
taccacagtggtttcaaccaaggctacaactttgctgaggcagtcaacttttgcactgct
gactggctgcctgctgggcgccaatgcattgagcactaccgccgactacgaagatactgt
gtcttttctcatgaggagctcatttgcaagatggctgcctgccctgagaaactggacctg
aacctggcagcagctgtacataaggagatgttcattatggtgcaagaggagcggcgtcta
cgaaaggctctgttggaaaaaggtatcaccgaggctgagcgagaggcttttgagctgctt
ccagatgatgaacgtcagtgcataaagtgcaagaccacatgtttcctatctgccctggct
tgctatgactgcccagatggccttgtctgcctttctcacatcaatgacctctgcaagtgc
tccagtagccgccagtaccttcggtatcggtacaccttggatgagctccctgccatgctg
cataaactgaaagttagagctgagtcctttgacacctgggctaacaaagtacgagtggcc
ctggaggtggaagatgggcggaagcgcagcctggaagaactgagagcactagaatctgag
gctcgtgagcgaaggtttcctaacagtgagcttctacagcgactgaaaaactgcctgagt
gaagcagaggcttgtgtgtcccgggctctgggattggtcagtggccaggaagctggccct
gacagggtggctggcctacagatgaccctggctgagctacgggattttctgggccagatg
aacaacctgccctgtgccatgcaccagattggggatgtcaagggtattctggaacaggtg
gaagcctaccagactgaggcccgtgaggccctggtctcacagccttccagtccagggctg
ctgcagtccttgttggagagaggacaacagctgggtgtggaggtacctgaagcccagcag
ctccaaaggcaggtggaacaggcgcggtggctggatgaggtaaaacgcacgctggctccc
tctgcccgaaggggtaccctggccatcatgcggggactgttggttgcgggcgccagtgta
gcccctagccctgctgtggataaggcccaggcagagcttcaggagctgctgaccatcgct
gaacgctgggaagagaaagcccacctctgcttagaggccaggcagaagcatccaccagcc
acacttgaggccataatccatgaagcagaaaacatccctgttcacttgcccaatatccag
tctctcaaggaggctcttgctaaggcccgggcatggattgctgatgtggatgagatccaa
aatggtgaccactacccttgcttggatgacttggagggcctcgtagctgtgggtcgggac
ctccctgtggggctggaggaactgagacagctagagctacaggtattgacagcacactcc
tggagagaaaaggcctccaagaccttcctcaagaagaactcctgctatacattattggag
gtgctctgcccgtgtgcagacgccggctcagacagcaccaaacgcagccggtggatggag
aaggagctggggttgtacaaatctgacacagagctgttggggctgtctgcgcaggacctc
agggacccaggctctgtgatcgtggccttcaaagagggggagcagaaggagaaggaaggg
atactgcagcttcgtcgtaccaactcagccaagccaagtccactggcactgttgacaaca
gcctcctctacagcttctatctgcgtgtgtgggcaagtgccagctggggtgggagctctg
cagtgtgacctgtgtcaggactggttccatgggcgctgtgtgacagtaccccgcctcctc
agctcccagaggtccagtcttccctcatccccactgctggcctggtgggaatgggacacc
aaattcttgtgccctctgtgtatgcgctcacggcgcccacgcttggaaaccatcctggca
ctgctggtagccctacagagactgcctgtgcggctgcctgagggtgaggctctacagtgc
ctcacagagagagccatcagctggcaaggccgtgccagacaggttttggcctctgaggaa
gtgactgctctgttgggacggctggctgaactgcgccaacggctacaggctgaatccaag
cctgaggagtccctggcttacccttcagatggtggagagggcactggcaatatgccgaag
gtccaggggctgttggagaatggggacagtgtgaccagtcctgaaaaggtagccacagag
gagggctcagatctggagctgctatcctcaatattaccacagttgtctggccctgtgttg
gaactgcctgaggcaacccgagccccactggaggaacttatgatggaaggggatctgctt
gaggtgaccctagatgagaatcatagcatctggcagctgctgcaggctgggcagcctcca
gacttgaagagggtccagacacttctggagctggagaaggcagagcgccatgggagtcgg
acacgaggccgagccctagagaggagacgacggaggaaggtggatcggggtggggagccg
gatgacccggcacgagaggagctagagccaaagagggtacgaagctcaggaccagaagcc
gaggaagtccaggaggaagaggagctggaggaggagactgggggtgaggtccctcctgta
cccttccccaacagtggcagccccagcatccaggaggaccaggatggcttagaaccagtg
ttagaggctggttctgacacctcagcccctttctctactctgacttcccggctgttgatg
tcctgcccacagcagccatctctgcaacaattgtga

DBGET integrated database retrieval system