KEGG   Mus musculus (mouse): 20604Help
Entry
20604             CDS       T01002                                 

Gene name
Sst, SOM, SRIF, SS, Smst
Definition
(RefSeq) somatostatin
  KO
K05237  somatostatin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04024  cAMP signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    20604 (Sst)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    20604 (Sst)
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    20604 (Sst)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Somatostatin
Motif
Other DBs
NCBI-GeneID: 20604
NCBI-ProteinID: NP_033241
MGI: 98326
Ensembl: ENSMUSG00000004366
UniProt: P60041 Q545V6
Position
16 B1; 16 15.0 cM
AA seq 116 aa AA seqDB search
MLSCRLQCALAALCIVLALGGVTGAPSDPRLRQFLQKSLAAATGKQELAKYFLAELLSEP
NQTENDALEPEDLPQAAEQDEMRLELQRSANSNPAMAPRERKAGCKNFFWKTFTSC
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcctgccgtctccagtgcgccctggctgcgctctgcatcgtcctggctttgggc
ggtgtcaccggcgcgccctcggaccccagactccgtcagtttctgcagaagtctctggcg
gctgccaccgggaaacaggaactggccaagtacttcttggcagagctgctgtccgagccc
aaccagacagagaatgatgccctggagcccgaggatttgccccaggcagctgagcaggac
gagatgaggctggagctgcagaggtctgccaactcgaacccagcaatggcaccccgggaa
cgcaaagctggctgcaagaacttcttctggaagacattcacatcctgttag

DBGET integrated database retrieval system