KEGG   Mus musculus (house mouse): 20692
Entry
20692             CDS       T01002                                 
Symbol
Sparc, BM-40, ON
Name
(RefSeq) secreted acidic cysteine rich glycoprotein
  KO
K24262  secreted protein acidic and rich in cysteine
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    20692 (Sparc)
Chaperones and folding catalysts [BR:mmu03110]
 Other chaperones and cochaperones
  Others
   20692 (Sparc)
SSDB
Motif
Pfam: SPARC_Ca_bdg Kazal_1 Kazal_2 FOLN hEGF EF-hand_1
Other DBs
NCBI-GeneID: 20692
NCBI-ProteinID: NP_033268
MGI: 98373
Ensembl: ENSMUSG00000018593
UniProt: P07214 Q5NCU5
Position
11:complement(55284985..55310906)
AA seq 302 aa
MRAWIFFLLCLAGRALAAPQQTEVAEEIVEEETVVEETGVPVGANPVQVEMGEFEDGAEE
TVEEVVADNPCQNHHCKHGKVCELDESNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDS
SCHFFATKCTLEGTKKGHKLHLDYIGPCKYIAPCLDSELTEFPLRMRDWLKNVLVTLYER
DEGNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQH
PIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALEEWAGCFGIKEQDINKDL
VI
NT seq 909 nt   +upstreamnt  +downstreamnt
atgagggcctggatcttctttctcctttgcctggccgggagggccctggcagcccctcag
cagactgaagttgctgaggagatagtggaggaggaaaccgtggtggaggagacaggggta
cctgtgggtgccaacccagtccaggtggaaatgggagaatttgaggacggtgcagaggaa
acggtcgaggaggtggtggctgacaacccctgccagaaccatcattgcaaacatggcaag
gtgtgtgagctggacgagagcaacacccccatgtgtgtgtgccaggaccccaccagctgc
cctgctcccattggcgagtttgagaaggtatgcagcaatgacaacaagaccttcgactct
tcctgccacttctttgccaccaagtgcaccctggagggcaccaagaagggccacaagctc
cacctggactacatcggaccatgcaaatacatcgccccctgcctggattccgagctgact
gaattccctctgcgcatgcgtgactggctcaaaaatgtcctggtcaccttgtacgagaga
gatgagggcaacaacctcctcactgagaagcagaagctgcgtgtgaagaagatccatgag
aatgagaagcgcctggaggctggagaccaccccgtggagctgttggcccgagactttgag
aagaactacaatatgtacatcttccctgtccactggcagtttggccagctggatcagcac
cctattgatgggtacctgtcccacactgagctggccccactgcgcgctcccctcatcccc
atggaacattgcaccacacgtttctttgagacctgtgacctagacaacgacaagtacatt
gccctggaggaatgggccggctgctttggcatcaaggagcaggacatcaacaaggatctg
gtgatctaa

DBGET integrated database retrieval system