KEGG   Mus musculus (house mouse): 20742
Entry
20742             CDS       T01002                                 
Symbol
Sptbn1, 9930031C03Rik, AL033301, SPTB2, Spnb-2, Spnb2, elf1, elf3, mKIAA4049
Name
(RefSeq) spectrin beta, non-erythrocytic 1
  KO
K06115  spectrin beta
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    20742 (Sptbn1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     20742 (Sptbn1)
  Intermediate filaments
   Intermediate filament-binding proteins
    20742 (Sptbn1)
SSDB
Motif
Pfam: Spectrin CH PH_9 PH CAMSAP_CH CENP-K
Other DBs
NCBI-GeneID: 20742
NCBI-ProteinID: NP_787030
MGI: 98388
Ensembl: ENSMUSG00000020315
UniProt: Q62261 Q8BQ35 Q3TZN6 Q8R1C2
Structure
Position
11:complement(30049395..30218384)
AA seq 2363 aa
MTTTVATDYDNIEIQQQYSDVNNRWDVDDWDNENSSARLFERSRIKALADEREAVQKKTF
TKWVNSHLARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKAL
QFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALL
LWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNL
AEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIET
EKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKG
NLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKL
EQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQA
VVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYI
MDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATDGEG
YKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKI
LSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERII
YIREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQ
SLVKKHKDVAEEITNYRPTIDTLHEQASALPQAHAESPDVKGRLAGIEERCKEMAELTRL
RKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNN
QASRVAVVNQIARQLMHNGHPSEKEIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNY
HLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAE
KLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSR
TQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFL
RQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTT
LEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKN
REAASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFM
AELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDAN
KAELFTQSCADLDKWLHGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQ
SQAQALSQEGKSTDEVDSKRLTVQTKFMELLEPLSERKHNLLASKEIHQFNRDVEDEILW
VGERMPLATSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITDSSSLNA
EAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEK
AKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLY
AGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERF
REFARDTGNIGQERVDTVNNMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQI
LAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQV
RQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACEGRRVRLVDTGDKFRFFSMV
RDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKSLLAR
KHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYL
SSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTLELLEVRRQQEEEERKRRP
PSPDPNTKVSEEAESQQWDTSKGDQVSQNGLPAEQGSPRMAGTMETSEMVNGAAEQRTSS
KESSPVPSPTLDRKAKSALPAQSAATLPARTLETPAAQMEGFLNRKHEWEAHNKKASSRS
WHNVYCVINNQEMGFYKDAKSAASGIPYHSEVPVSLKEAICEVALDYKKKKHVFKLRLSD
GNEYLFQAKDDEEMNTWIQAISSAISSDKHDTSASTQSTPASSRAQTLPTSVVTITSESS
PGKREKDKEKDKEKRFSLFGKKK
NT seq 7092 nt   +upstreamnt  +downstreamnt
atgacgaccacggtagccacagactatgacaacattgagatccagcagcagtacagtgat
gtgaacaaccgctgggatgtggatgactgggacaatgagaacagctctgcaaggctcttt
gagcgctcccgcatcaaggccctggcagatgagcgtgaagctgtacagaagaagaccttc
accaagtgggtcaattcccaccttgcgagagtgtcctgccgaatcacagacctgtacacg
gaccttcgagatggacggatgctcatcaagctactggaggtcctctctggagagaggctg
cctaaacccactaagggacggatgcggatccactgtctggagaatgtcgacaaggctctt
caattcctgaaagagcagagagtccatcttgagaacatgggctcccatgacattgtggat
ggaaaccaccggctgaccctcggcctcatctggacaattattctgcgcttccagatccag
gatattagtgtggagactgaagataacaaagagaaaaagtctgctaaggatgcattgctg
ctgtggtgccagatgaagacagctgggtaccccaatgtcaacattcacaatttcaccact
agctggagggatggcatggccttcaatgcactgatacataaacatcggcctgacctgata
gattttgataaactgaagaaatctaatgcacactacaatctgcagaatgcatttaacctg
gcagagcagcaccttggcctcactaaactgttagaccctgaagatatcagtgtggaccac
cctgatgagaagtctatcatcacatacgtggtgacttactaccactacttctccaagatg
aaggccttggctgtcgaaggaaagcgcattggaaaggtgcttgataatgctatagaaaca
gagaaaatgattgagaagtacgagtcacttgcttctgaccttctggagtggattgaacaa
accatcatcatcctaaacaaccgcaaatttgctaattcactggttggggtccagcagcag
ctccaggcattcaacacgtaccgcacagtggagaaaccacctaagtttactgagaagggg
aatttggaggtgctccttttcacaattcagagcaagatgcgagcgaataatcagaaggtc
tacatgccccgcgaggggaagctcatctctgacatcaacaaggcctgggaaagactggaa
aaagcagaacatgagagagaactggctctgcggaatgagctcatacggcaggaaaaactg
gaacaactcgcccgaagatttgatcgcaaggcagctatgagggagacatggctgagtgaa
aaccagcgtcttgtgtctcaggacaactttggatttgaccttcccgctgttgaggctgct
accaaaaaacacgaggccattgagacagacatcgctgcatatgaagaacgagttcaggcc
gtggtggctgtggccagggaacttgaagccgagaactaccatgacatcaagcgcatcaca
gcgaggaaggacaatgtcatccggctctgggaatacttgctggaactgctcagggccagg
aggcagcgtcttgagatgaacctgggattgcaaaagatattccaggaaatgctttatatt
atggactggatggatgaaatgaaggtgctattgctgtctcaagactatggcaaacactta
cttggtgttgaagacctgttacagaagcatgccctggttgaagcagacattgcaatccaa
gcagagcgtgtaagaggtgtgaatgcctctgcccagaagtttgcaacagatggggaaggc
tacaagccatgtgacccccaggtaattcgagaccgtgttgcccacatggagttctgctat
caagagctttgtcagctggctgccgagcgtagggctcgcctggaagagtcccgtcgcctc
tggaagttcttctgggagatggcagaagaggaaggctggatacgagagaaggagaagatc
ctgtcctctgatgattacgggaaagacttgaccagtgtcatgcgcctgctgagcaagcac
cgggcatttgaggatgagatgagtggccgtagtggccattttgagcaggccattaaagaa
ggtgaagacatgattgcagaggaacactttggatcggaaaagatccgtgagagaatcatt
tatatccgggagcagtgggccaacctggaacagctctcagccattaggaagaagcgccta
gaggaagcctcattactgcaccagttccaggctgatgctgatgatattgatgcttggatg
ttagatatactcaagattgtctccagcaatgatgtgggccatgatgagtactccacgcag
tctctggtcaagaagcataaagatgtagcagaagagatcaccaactacaggcccactatt
gacacactgcatgagcaagccagtgcccttccacaagcacatgcagagtctccagatgtg
aagggccggctggcaggaattgaggagcgctgcaaggagatggcagagttaacacggcta
aggaagcaggctctgcaggacaccctggccctgtacaagatgttcagtgaggctgatgcc
tgtgagctctggattgacgagaaggagcagtggctcaacaacatgcagatcccagagaag
ctggaggacctggaagtcatccagcacagatttgagagcctagaaccagaaatgaacaac
caggcttcccgggttgctgtggtgaaccagattgcacggcagctgatgcacaatggccac
cccagtgaaaaggaaatcagagctcagcaagacaaactcaacacgaggtggagtcagttc
agagaactggtggacaggaaaaaggatgctcttctgtctgccctgagcatccagaactac
cacctcgagtgcaatgaaaccaaatcctggatccgggagaagaccaaggtcatcgagtct
acccaagaccttggcaatgacctggcaggtgtcatggccctgcagcgcaagctgactggc
atggaacgagacttggtagccattgaggcgaagctgagtgacctgcagaaagaagctgag
aagctggagtccgagcaccctgaccaggctcaagctatcctgtctcggctggccgagatc
agtgatgtgtgggaggaaatgaagacaaccctgaagaaccgagaggcctccctgggagag
gccagcaagctgcagcagtttctgcgggacttggacgacttccagtcttggctctccagg
acccagactgctatcgcctcagaggacatgcccaataccctcactgaggcagagaagctt
ctcacacagcacgagaatatcaaaaatgagatcgacaattatgaggaagactaccagaag
atgcgggacatgggcgagatggtcacccaggggcagactgatgcccagtatatgtttctg
cggcagcggctgcaggccttagacactggctggaatgagctccacaaaatgtgggagaac
aggcaaaacctcctctcccagtcccatgcctaccagcagttccttagggacaccaaacaa
gctgaagcttttcttaataaccaggagtatgttttggctcatactgaaatgcccaccacc
ctggaaggagctgaagcagccattaaaaagcaggaggacttcatgaccaccatggatgcc
aacgaggagaagatcaatgctgttgtggagactggccgaagactggtgagcgatgggaac
atcaactccgaccgcatccaggagaaggtggactctattgacgacagacacaggaagaat
cgagaagcagccagtgaacttctgatgaggttaaaggacaaccgtgatctacagaagttc
ctgcaagattgtcaagagctgtccctctggatcaatgaaaagatgcttacagctcaagac
atgtcttatgatgaagccagaaatctgcacagtaaatggttaaagcatcaagcatttatg
gcggaacttgcatccaacaaagaatggcttgacaaaattgagaaggaaggaatgcagctt
atttcagaaaagccagaaacagaagctgtggtaaaggaaaaactcactggtttacataaa
atgtgggaagtccttgaatccacaacccagaccaaggcccagcggctctttgatgcaaat
aaggctgagcttttcacacaaagctgcgcagatcttgacaaatggctacatggcctggag
agccagattcaatctgacgactatggcaaagaccttaccagtgtcaatattcttctgaaa
aagcaacagatgctggagaatcagatggaagttcggaagaaagagatcgaggaactgcag
agccaagcccaggcgctgagtcaggaggggaagagcacagatgaggtggacagcaaacgc
cttactgtgcagaccaagttcatggagcttctggagcccttgagtgagaggaagcataac
ctgttagcttccaaggagatccatcagttcaacagggatgtggaggacgaaatcctatgg
gttggcgagaggatgcctttggcaacttccacagatcatggccataaccttcaaactgtg
cagctgttaataaagaaaaaccagaccctccagaaagaaatccagggacaccagcctcgt
attgatgacatctttgagaggagtcaaaacatcatcacagatagcagcagcctcaatgcc
gaggctatcaggcagaggctcgctgacctgaagcagctgtgggggctcctcattgaggaa
actgagaaacgccatagacggctggaggaggcacacaaggcgcagcagtactactttgat
gcagctgaagccgaggcatggatgagtgaacaggagttgtacatgatgtctgaggaaaag
gccaaggatgagcagagtgctgtctctatgttgaaaaagcaccagattttagagcaagct
gttgaggactatgcagagacagtacaccagctctccaagactagccgggcgctggtggct
gacagccatcccgaaagtgagcgtattagcatgcggcagtcaaaggtcgacaagctgtat
gctggcctgaaggaccttgctgaggagaggagaggaaaacttgatgagaggcacaggctg
ttccagctcaacagagaggtggatgacctggaacagtggatcgctgagagggaagtggtc
gcaggctcccatgagttgggacaggactatgagcatgtcacgatgttacaagaacggttc
cgagaatttgctcgagacacaggaaacattgggcaggagcgtgtggatacagttaataac
atggcagatgaactcatcaactctggacattcagatgctgccaccattgctgagtggaaa
gatggtctcaatgaagcctgggctgacctcctggagctcattgacacaagaacacagatt
cttgctgcctcatatgaacttcataagttttaccatgatgccaaggagatctttggccga
atccaggacaaacacaagaaactccctgaggagcttggaagagatcaaaacactgtggaa
actttacagagaatgcacaccacctttgagcacgacatccaagctctgggcactcaggtg
aggcagctgcaggaggatgcagctcgcctccaggcagcctatgcaggggacaaggctgat
gacatccagaagcgtgagaatgaggtcctggaagcctggaagtccctgctggatgcttgt
gagggtcgcagggtgcggctggtagacacaggagacaagttccgcttcttcagcatggtg
cgtgacctcatgctctggatggaagatgtcatccggcagatcgaggcccaggagaaacca
cgggatgtgtcatctgttgaactgttaatgaataatcatcaaggtatcaaagctgaaatt
gatgctcgtaatgacagctttacagcctgcattgagcttgggaaatccctgctggcacgg
aaacactatgcttctgaggagatcaaggaaaagttactgcagctgacagagaaaagaaaa
gaaatgattgacaagtgggaagaccggtgggagtggttaagactgattttggaggtccat
cagttctcaagggatgccagtgtggcagaggcttggctgcttggacaggaaccataccta
tccagccgtgaaattggccagagtgtagacgaagtggagaagcttattaagcgccatgag
gcgtttgaaaagtctgcagcgacctgggatgagagattctctgctctggaaaggctgaca
acgttggagctactggaagtgcgcagacagcaagaggaagaagaaagaaagaggcggcca
ccttctccggacccaaacacgaaggtttcagaggaggctgagtcccagcaatgggatact
tcaaaaggagaccaagtttcccagaatggtttgccggctgagcagggatctccacggatg
gcaggaaccatggaaacgagtgaaatggtcaacggtgctgctgagcagaggacaagctcc
aaagagtccagtcctgttccctctcccaccttggaccgaaaggccaaatctgcacttcca
gcccagagtgctgccaccctgccagccaggaccctggagacacccgctgcccagatggaa
ggcttcctcaatcggaagcatgagtgggaggcccacaataagaaagcctcgagcaggtcc
tggcacaatgtatattgtgtcataaataaccaagaaatgggcttctataaagatgccaag
agtgctgcttctggcatcccctaccacagtgaggtccctgtgagtttgaaagaggccatc
tgcgaagtggcccttgattacaaaaagaagaagcacgtgttcaagctaagactaagtgat
ggaaacgagtacctcttccaagccaaagatgatgaggaaatgaacacatggatccaggct
atctcctctgccatctcctctgacaaacacgacacatctgccagcacccagagtacgcca
gcatccagtcgggcgcagaccttacccaccagcgtcgtcaccatcaccagcgagtccagt
cctggcaagagggagaaggataaagagaaagacaaagagaagaggttcagccttttcggc
aagaagaagtga

DBGET integrated database retrieval system