KEGG   Mus musculus (mouse): 20979
Entry
20979             CDS       T01002                                 

Gene name
Syt1, AW124717, G630098F17Rik, SytI
Definition
(RefSeq) synaptotagmin I
  KO
K15290  synaptotagmin-1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04721  Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04721 Synaptic vesicle cycle
    20979 (Syt1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    20979 (Syt1)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Synaptotagmins
    20979 (Syt1)
SSDB
Motif
Pfam: C2 Comm CEP76-C2 Shisa EphA2_TM MAP17 DUF1258 Herpes_gE RCR
Other DBs
NCBI-GeneID: 20979
NCBI-ProteinID: NP_001239270
MGI: 99667
Ensembl: ENSMUSG00000035864
Vega: OTTMUSG00000016266
UniProt: P46096 H6RXZ1
Structure
PDB: 
5VFE 5VFF 5T0S 5VFG 5T0R

Position
10 D1; 10 56.52 cM
AA seq 421 aa
MVSASRPEALAAPVTTVATLVPHNATEPASPGEGKEDAFSKLKQKFMNELHKIPLPPWAL
IAIAIVAVLLVVTCCFCVCKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKD
DDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPY
VKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDII
GEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLK
KMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVT
VLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVK
K
NT seq 1266 nt   +upstreamnt  +downstreamnt
atggtgagtgccagtcgtcctgaggccctggctgcccctgtcaccactgttgcgaccctt
gtcccacacaacgccactgagccagccagtcctggggaagggaaggaagatgccttttcc
aagctgaagcagaagtttatgaatgaactgcataaaatcccattgccaccgtgggcctta
attgccatagccatagttgcggtccttctagtcgtgacctgctgcttctgtgtctgtaag
aaatgtttgttcaaaaagaaaaacaagaagaagggaaaggaaaagggagggaagaacgcc
attaacatgaaagacgtgaaagacttagggaagaccatgaaggatcaggcccttaaggat
gacgatgctgaaactggactgactgatggagaagaaaaggaggagcccaaggaagaggag
aaactgggaaagcttcaatattcactggactatgacttccagaataaccagctgctggtg
ggaatcatccaggctgctgaactgcccgccctggacatgggaggcacatctgatccatac
gtcaaagtcttcctgctgcccgacaaaaagaagaagtttgagacaaaagtccaccggaaa
accctcaatccagtcttcaatgaacagtttactttcaaggtgccatactcggaattaggt
ggcaagacactggtgatggctgtgtatgattttgaccgcttctccaagcacgacatcatt
ggagagttcaaagttcctatgaacaccgtggattttggccacgtcaccgaggagtggcgc
gatctccagagtgctgagaaagaagagcaagagaaactgggtgacatctgcttctccctc
cgctacgtccctactgccggcaagctgactgttgtcattctggaagccaagaacctgaag
aagatggatgtgggtggcttatctgatccctatgtaaagattcacctgatgcagaacggc
aagagactgaagaagaaaaagacaacgattaagaagaacacacttaacccctactacaat
gagtccttcagctttgaagttccgttcgagcaaatccagaaagtgcaagtggtggtaact
gttttggactatgacaagattggcaagaacgacgccatcggcaaagtctttgtgggctac
aacagcaccggcgcagagctgcgacactggtcagacatgctggccaacccccggcgaccc
atcgcccagtggcacactctgcaggtagaggaggaggttgatgccatgctggctgtcaag
aagtaa

DBGET integrated database retrieval system