KEGG   Mus musculus (house mouse): 210274
Entry
210274            CDS       T01002                                 
Symbol
Shank2, ProSAP1, mKIAA1022
Name
(RefSeq) SH3 and multiple ankyrin repeat domains 2
  KO
K15009  SH3 and multiple ankyrin repeat domains protein
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04724  Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    210274 (Shank2)
SSDB
Motif
Pfam: SAM_1 SAM_2 SH3_2 SH3_9 PDZ_6 PDZ SH3_1 SAM_4 SAM_PNT
Other DBs
NCBI-GeneID: 210274
NCBI-ProteinID: NP_001106844
MGI: 2671987
Ensembl: ENSMUSG00000037541
UniProt: Q80Z38
Position
7:143531819..143979780
AA seq 1472 aa
MKSLLNAFTKKEVPFREAPAYSNRRRRPPNTLAAPRVLLRSNSDNNLNAGAPEWAVCSAA
TSHRSLSPQLLQQTPSKPDGATKSLGSYTPGPRSRSPSLNRLGGTAEDGKRTQPHWHVGS
PFTPGANKDSLSTFEYPGPRRKLYSAVPGRLFVAVKPYQPQVDGEIPLHRGDRVKVLSIG
EGGFWEGSARGHIGWFPAECVEEVQCKPRDSQAETRADRSKKLFRHYTVGSYDSFDAASD
CIIEDKTVVLQKKDNEGFGFVLRGAKADTPIEEFTPTPAFPALQYLESVDEGGVAWQAGL
RTGDFLIEVNNENVVKVGHRQVVNMIRQGGNHLILKVVTVTRNLDPDDTARKKAPPPPKR
APTTALTLRSKSMTAELEELVDKASVRKKKDKPEEIVPASKPSRTAENVAIESRVATIKQ
RPTSRCFPAASDVNSVYERQGIAVMTPTVPGSPKGPFLGLPRGTMRRQKSIDSRIFLSGI
TEEERQFLAPPMLKFTRSLSMPDTSEDIPPPPQSVPPSPPPPSPTTYNCPRSPTPRVYGT
IKPAFNQNPVVAKVPPATRSDTVATMMREKGMFYRRELDRFSLDSEDVYSRSPAPQAAFR
TKRGQMPENPYSEVGKIASKAVYVPAKPARRKGVLVKQSNVEDSPEKTCSIPIPTIIVKE
PSTSSSGKSSQGSSMEIDPQATEPGQLRPDDSLTVSSPFAAAIAGAVRDREKRLEARRNS
PAFLSTDLGDEDVGLGPPAPRMQASKFPEEGGFGDEDETEQPLLPTPGAAPRELENHFLG
GGEAGAQGEAGGPLSSTSKAKGPESGPAAPLKSSSPAGPENYVHPLTGRLLDPSSPLALA
LSARDRAMQESQQGHKGEAPKADLNKPLYIDTKMRPSVESGFPPVTRQNTRGPLRRQETE
NKYETDLGKDRRADDKKNMLINIVDTAQQKSAGLLMVHTVDVPMAGPPLEEEEDREDGDT
KPDHSPSTVPEGVPKTEGALQISAAPEPAVAPGRTIVAAGSVEEAVILPFRIPPPPLASV
DLDEDFLFTEPLPPPLEFANSFDIPDDRAASVPALADLVKQKKNDTSQPPTLNSSQPANS
TDSKKPAGISNCLPSSFLPPPESFDAVTDSGIEEVDSRSSSDHHLETTSTISTVSSISTL
SSEGGESMDTCTVYADGQAFVVDKPPVPPKPKMKPIVHKSNALYQDTLPEEDTDGFVIPP
PAPPPPPGSAQAGVAKVIQPRTSKLWGDVPEVKSPILSGPKANVISELNSILQQMNRGKS
VKPGEGLELPVGAKSANLAPRSPEVMSTVSGTRSTTVTFTVRPGTSQPITLQSRPPDYES
RTSGPRRAPSPVVSPTELSKEILPTPPPPSATAASPSPTLSDVFSLPSQSPAGDLFGLNP
AGRSRSPSPSILQQPISNKPFTTKPVHLWTKPDVADWLESLNLGEHKETFMDNEIDGSHL
PNLQKEDLIDLGVTRVGHRMNIERALKQLLDR
NT seq 4419 nt   +upstreamnt  +downstreamnt
atgaagtctttgttaaatgccttcaccaagaaggaagtgcccttcagagaggccccagct
tattccaaccgcaggcggcggccccccaacacattggctgcccccagagttcttctgcgt
tctaatagtgacaacaacctcaatgctggtgcacctgaatgggctgtctgctctgcagcc
acctcccaccgaagcctctcaccccaactgctgcagcagacacccagcaaacctgatgga
gccaccaagagccttggaagctatacccctgggccccgcagccgttccccttcactcaac
aggctgggtggtactgctgaggatggcaagaggacacagccacattggcatgtggggtcg
cccttcactcctggtgccaacaaggactccctctcgacctttgagtacccagggcccagg
aggaagctatatagtgcggtgcctgggagactcttcgtcgccgtcaagccataccaaccc
caagtcgacggcgagatcccccttcaccgaggcgacagggtcaaagttctgagcatcgga
gagggcggcttctgggaaggcagtgcccgtggccacatcgggtggttcccagctgagtgt
gtggaagaggtgcagtgtaaaccccgggacagccaggcagaaacccgcgcggaccgcagc
aagaagctcttccggcattacacggtgggctcctatgacagctttgatgctgccagtgac
tgcattattgaggacaagacggtggtcctgcaaaagaaggacaacgagggctttggattt
gtgctccgaggggcaaaagccgatacccccattgaggaattcacacccacgccagcattt
ccagccctgcagtacctggagtccgtggatgaaggtggggtggcatggcaagccggacta
aggaccggggacttcttgattgaggttaacaatgaaaatgtcgtcaaggtgggccacagg
caggtggtgaacatgatccgccagggagggaatcacctcatccttaaggtcgtcacggtg
accaggaatctagaccctgatgatacagccagaaagaaagctcccccacctccaaagcgg
gctccgaccacggccctcaccctgcgttccaagtccatgacagcggagttggaggaactc
gtggacaaagcctcagtccggaagaagaaggataaaccggaagagatagtcccagcctcc
aagccctccaggactgcagagaacgtggccatcgaatccagggtggcgaccatcaagcag
cggcccacaagccggtgcttcccagctgcctctgatgtgaattccgtgtacgagcgccaa
gggattgctgtaatgacgcccacggtccctgggagcccgaaaggcccatttctgggcctc
cctcgaggtacgatgcgaaggcagaaatcgatagacagcagaatctttctatcagggata
acagaggaagagcggcagtttctggctcccccaatgctgaagttcacccgaagcttgtcc
atgccagacacttctgaggacatcccccctccgccacagtctgtgcccccctctccccct
cctccttcccccaccacatacaactgtcccaggtccccgactccaagagtctatgggaca
attaagcccgcgttcaatcagaaccccgtcgtcgccaaggtgcccccagccaccaggtct
gacactgtggccaccatgatgcgggaaaaggggatgttctacaggagagagctggacaga
ttttccctggactcagaagacgtctacagccgcagccccgccccacaggccgccttccgc
accaagcggggacagatgcctgagaacccgtactcagaggtgggaaagatagccagcaag
gccgtctatgtccctgccaagccagccaggcggaagggcgtgctggtaaagcagtccaac
gtggaggatagccccgagaagacgtgctccatacccatcccaaccatcatcgtcaaggaa
ccctccaccagcagcagcggcaagagcagccaggggagcagcatggagattgacccccag
gccaccgagcccggccagctgcggccagatgacagcctcaccgtcagcagcccctttgct
gcggccatcgctggggctgtgcgtgaccgggagaagcgtctggaagccaggaggaattcc
ccagccttcctctccaccgacctgggagatgaggacgtgggtctggggccgcctgctccc
cggatgcaggcctccaagttcccagaggagggtgggtttggtgacgaggatgagacggaa
caaccgctgttgcctacccccggggcagcacccagggagctggagaatcacttcctaggt
ggtggtgaggctggtgctcagggggaggctgggggacccctgagttccacatccaaagcc
aaggggcctgagagtggcccagcagcccccctcaagagcagcagcccagccggccctgag
aattacgtgcacccactcacagggcggctgcttgaccccagctccccactggccctggca
ctctcagccagggaccgagccatgcaggagtcccagcaggggcacaaaggagaggccccc
aaggctgaccttaacaagcctctctacatcgataccaaaatgcggcccagcgtggagtcc
ggctttcctccagtcaccagacagaacaccaggggtcccctgcgacggcaagagacagag
aacaagtacgagacagacctgggcaaggaccggagggcggacgacaagaagaacatgctg
atcaacatcgtggacactgcccagcagaagtcagctggcctactgatggtgcacacagtg
gacgtccccatggccgggccacccctggaggaagaggaggacagagaggatggggataca
aagccagaccactcaccctccacagtgccagaaggcgttcccaaaaccgaaggtgcttta
cagatctccgctgccccggagcccgccgtcgcgcccggcaggaccatcgtggcggcgggc
tccgtggaagaggcggtgattctgccattccgcatcccccctccccctctggcatccgtg
gacttggatgaggactttcttttcacagaaccgttgcctccccccctggaattcgccaat
agttttgatatccccgatgaccgggcagcttcagttcccgctctggctgacctggtcaag
cagaagaaaaacgacacctctcagccccctacgttgaactccagccaaccagccaactcc
acagacagtaagaagccagccggtatctcgaactgtctgccctcctcgttcctgccaccc
cccgaaagtttcgatgcagtcaccgactcggggattgaggaggtggacagccggagtagc
agcgaccaccacctggagactaccagcaccatctccacggtgtccagcatctccacgctg
tcctcagagggcggcgagagcatggacacctgcacagtctatgcagacgggcaagccttt
gtggttgacaagcccccagtacctccaaagccaaaaatgaagcccatcgttcacaagagc
aacgcactttaccaagacacgctcccagaagaggacacggatggctttgtgatcccccca
cctgcacccccgcccccgccgggcagcgcccaggccggtgtggcgaaggtcatccagcca
aggacctccaagttgtggggtgacgttccagaggtcaaaagcccaattctctcaggccca
aaggcaaatgtcattagtgagctaaactccattctgcagcagatgaacagggggaaatcg
gtcaagcccggggaagggctggagctgccggtgggagccaagtcggccaacctcgctcca
agaagcccggaggtcatgagcaccgtctcaggtacacggagcacgacggtcaccttcact
gtccgccctggcacctcccagcccatcaccctgcagagccggccccccgactatgaaagc
agaacctcaggacctagacgcgccccaagccctgtggtttcaccaacggaattgagcaaa
gagatcctgcccacccctccccctccgtccgccactgcagcctctccctcccccacactc
tcagatgtctttagccttccgagccagtcccctgcaggggacctctttggcttgaaccca
gcaggacggagcaggtcaccatctccttcaatattgcaacagccaatctcaaataagcct
tttacaactaagcctgtccacctgtggacgaaaccagatgtggcagactggctggaaagt
ctgaacttgggtgaacacaaggagacgttcatggacaatgagattgacggcagccacctg
ccaaaccttcagaaggaagacttgatagatcttggggtgactcgagttgggcataggatg
aacatagaaagggctttgaaacagctgctggacagataa

DBGET integrated database retrieval system