KEGG   Mus musculus (mouse): 212276
Entry
212276            CDS       T01002                                 

Symbol
Zfp748, KRAB-O, Rslcan20/21, Zfp208, mszf54
Name
(RefSeq) zinc finger protein 748
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    212276 (Zfp748)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    212276 (Zfp748)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    212276 (Zfp748)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf_UBZ zf-C2H2_11 Zn-ribbon_8 zf-C2H2_8 zf-met zf-MYND Desulfoferrod_N zf-C2H2_6
Other DBs
NCBI-GeneID: 212276
NCBI-ProteinID: NP_001030308
MGI: 1916455
Ensembl: ENSMUSG00000095432
Vega: OTTMUSG00000042798
UniProt: Q7TPL6 Q3V1X2
Position
13:complement(67686760..67701271)
AA seq 888 aa
MEEMLSFRDVAVDFSAEEWECLEPAQWNLYRDVMLENYSHLVFLGLAFSKPYLVTFLEQR
QEPLNEKRQVATTMHPDIKPYKCKECGKACDWNSLLLEHQRTNPGENAYKCEECGQASGS
YSVIPEHHINDTEEKACKCEECGKVICTCSENSSYQRICIGENPYKCEECGKAFSSHSCL
AQHEVEHTGQQFYNCEECGKLFYCPSHLTEHQKIHSQENLFKIEVCSEVFCAPIELSKDQ
NFCTEEKPYRYEDYVKAFSACSVLSEHPTIHPGEKAFKCEECGNAFCTLHSVSKMKIHYE
VKSYKCEECGKAFATHLSLIQHKIGHTREKPYQCEECGKMFYCSSNLKQHQITHSQEKPY
KCEVCGKVFRTCWQLSKHLRIHSGEKPYKCEECGKAFYTLSYLTQHKLGHTGEKPYKCEE
CGKTFYYPSVLKEHLAIHSGEKPYRCDECGKDFCTRSGRSRHQRIHTGEKPYKCEQCGKA
FSTHSYLSHHKIVHTGHKPYKCEECGKKFYYPSRLKEHQRIHSQENPYKCEICGKAFYTH
SYFTQHKLGHTGEKPYKCEECGKTFYYPSILKEHLAIHSGKKPYRCEECGKDFCTRSGRS
RHQRIHTGEKPHKCEECGKVFSTHSYLTQHKVVHSGEKPYKCEECGKKFYYPSRLKEHQR
IHSQENPYKCEICGNVFCTPKGLSKHQRFHTGEKPYKCEECGKMFYYPSRLKEHQRIHSQ
ENPYKCEICGKAFYTHSYLTQHKLGHTGEKPYKCEECGKTFYYPSILKEHLAIHSGKKPY
RCEECGKDFCTRSGRSRHQRIHTGEKPYKCEQCGKAFSTHSYLSQHKVVHSGEKPYKCEE
CGKMFYYSSRLKEHQRIHSQENPYKCEVCGKVFSAHLELATHLSIHSG
NT seq 2667 nt   +upstreamnt  +downstreamnt
atggaggaaatgctgtcattcagggatgtggccgttgatttctctgcagaggagtgggag
tgcctggagcctgctcagtggaatctgtacagggacgtgatgctggagaattacagccac
cttgtgttcctgggtcttgctttctctaagccatacctggtcacgtttctggagcaaaga
caagagcctttgaatgagaagagacaagtggccaccaccatgcacccagatataaaacca
tataaatgtaaagaatgtggcaaagcctgtgattggaactcactccttctcgaacaccag
agaaccaatccaggagagaatgcctacaagtgtgaagaatgtggtcaggcttctggctct
tactcagtaattcctgaacaccatataaacgatacggaagagaaagcctgcaagtgtgaa
gaatgtggtaaagtcatttgtacttgctcagaaaattctagctaccagagaatttgcatt
ggagaaaacccctacaagtgtgaagaatgtggaaaagccttttcttctcattcatgtctt
gctcaacatgaggtagaacacactggacagcaattttataactgtgaagaatgtgggaaa
ctgttttattgtccttctcaccttacagaacatcaaaaaattcattctcaagagaatctc
tttaagattgaggtatgtagcgaggtcttttgtgctcccatagaactttctaaagaccag
aacttttgtactgaagaaaaaccctacaggtatgaagactatgttaaggcctttagcgct
tgctcagttctttctgaacacccgacaattcatccaggagagaaagcattcaagtgtgaa
gaatgtggcaatgccttttgtacactccattcagtctctaaaatgaaaattcattatgaa
gtgaaatcctacaagtgtgaagagtgtgggaaagcctttgctactcatctttccctgatt
cagcataagataggtcatactcgagagaaaccttatcaatgtgaagaatgtggcaaaatg
ttttactgttcttcaaaccttaagcaacatcaaataactcattctcaagagaaaccctac
aagtgtgaagtatgtggcaaggtctttagaacttgctggcaactttctaaacacctgaga
atccattctggagagaaaccatacaagtgtgaggaatgtggcaaagccttttatactctc
tcctaccttactcagcacaaattaggtcacactggggagaaaccttacaaatgtgaggaa
tgtggcaaaaccttttactacccttcagtccttaaggaacacctagcaattcattctgga
gagaaaccgtacaggtgtgatgaatgtggcaaggacttttgtactcgctcaggacgttcc
agacaccagagaatccatactggagagaaaccgtacaagtgtgagcaatgtggaaaggcc
ttcagtacccattcatacctttctcatcacaagatagttcacactggacataaaccctac
aagtgtgaagagtgtggcaaaaaattttattatccttctcgacttaaggagcatcaaagg
attcattctcaagagaatccctacaagtgtgaaatatgtggcaaagccttttatactcac
tcatactttacccagcacaaattaggtcacactggggagaaaccttacaaatgtgaggaa
tgtggcaaaaccttttactacccttcaatccttaaggaacacctagcaattcattctgga
aagaaaccgtacaggtgtgaagaatgtggcaaggacttttgtactcgctcaggacgttcc
agacaccaaagaatccatactggagagaaaccccacaagtgtgaagaatgcggaaaagtc
ttttctactcattcatatcttactcagcacaaagtagtccactctggagagaagccctac
aagtgtgaagagtgtggcaaaaagttttactatccttctcgccttaaggagcatcaaagg
attcattctcaagagaatccttacaagtgtgaaatatgtggcaatgtattttgtactccc
aaaggactttcgaaacaccagagatttcatactggagagaaaccctacaagtgtgaagaa
tgcgggaaaatgttttattatccttctcgacttaaggaacatcaaagaattcattctcaa
gagaatccttacaagtgtgaaatatgtggcaaagccttttatactcactcctaccttact
cagcacaaattaggtcatactggggagaaaccttacaaatgtgaggaatgtggcaaaacc
ttttactacccttcaatccttaaggaacacctagcaattcattctggaaagaaaccgtac
aggtgtgaagaatgtggcaaggacttttgtactcgctcaggacgttccagacaccagaga
atccatactggagagaaaccctacaagtgtgagcaatgtggaaaggccttcagtactcac
tcatacctttctcaacacaaggtagtccactctggagagaagccctacaagtgtgaagag
tgtggcaaaatgttttactattcttctcgacttaaggagcatcaaaggattcattctcaa
gagaatccctacaagtgtgaagtgtgtggcaaagtctttagtgctcacttagaacttgct
acccacctaagtattcattccggataa

DBGET integrated database retrieval system