KEGG   Mus musculus (house mouse): 21372
Entry
21372             CDS       T01002                                 
Symbol
Tbl1x, 5330429M20, Tbl1
Name
(RefSeq) transducin (beta)-like 1 X-linked
  KO
K04508  transducin (beta)-like 1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    21372 (Tbl1x)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    21372 (Tbl1x)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HDAC complexes
    SMART complex
     21372 (Tbl1x)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 NBCH_WD40 eIF2A LisH RMC1_N Ge1_WD40 PD40 Alpha_GJ Nup160
Other DBs
NCBI-GeneID: 21372
NCBI-ProteinID: NP_065626
MGI: 1336172
Ensembl: ENSMUSG00000025246
Position
X:76553053..76706591
AA seq 527 aa
MSITSDEVNFLVYRYLQESGFSHSAFTFGIESHISQSNINGTLVPPAALISILQKGLQYV
EAEISINEDGTVFDGRPIESLSLIDAVMPDVVQTRQQAFREKLAQQQANAAAAAAAAAAT
ATSTAATTPAAAAQQNPPKNGEATVNGEENGAHAINNHSKPMEIDGDVEIPPSKATVLRG
HESEVFICAWNPVSDLLASGSGDSTARIWNLNENSNGGSTQLVLRHCIREGGHDVPSNKD
VTSLDWNSDGTLLATGSYDGFARIWTEDGNLASTLGQHKGPIFALKWNKKGNYILSAGVD
KTTIIWDAHTGEAKQQFPFHSAPALDVDWQNNTTFASCSTDMCIHVCRLGCDRPVKTFQG
HTNEVNAIKWDPSGMLLASCSDDMTLKIWSMKQDACVHDLQAHSKEIYTIKWSPTGPATS
NPNSNIMLASASFDSTVRLWDVERGVCIHTLTKHQEPVYSVAFSPDGKYLASGSFDKCVH
IWNTQSGSLVHSYRGTGGIFEVCWNARGDKVGASASDGSVCVLDLRK
NT seq 1584 nt   +upstreamnt  +downstreamnt
atgagcattaccagcgacgaggtgaactttctggtatatcgctacctccaggaatcaggt
ttttcccactctgccttcacgtttgggatcgaaagtcacattagccagtccaacatcaat
ggtacactagtgccaccggctgccctaatctccattcttcagaaaggactgcagtatgtg
gaggcggagatcagcatcaacgaggatggcacggtatttgatgggcgtcccattgagtcc
ctatcgttaattgatgctgtgatgcccgatgtggtacagacaagacagcaagcttttcgg
gagaaacttgcccagcagcaagccaatgcagcagctgcagcagcagcagctgcagccaca
gccacaagcacagcggctacaacaccagcagctgctgctcagcaaaacccaccaaagaat
ggagaagccaccgtgaatggggaagaaaatggagcccatgcaataaataatcactcaaag
ccaatggaaatagatggagacgttgaaattccaccgagtaaagccacagtccttcgaggc
catgagtctgaggtcttcatttgtgcctggaatcctgttagtgacctacttgcttctgga
tctggagactccactgcgaggatatggaaccttaatgagaacagcaacgggggctccaca
cagcttgtgctgaggcactgtatacgtgaaggtggacatgatgttcccagtaataaggat
gtcacttcattggactggaatagcgatggaacactgttggcaacaggttcctatgatggt
tttgcaagaatatggacagaagatggtaacctagccagcaccttaggtcaacataaaggt
cccatctttgctttgaagtggaacaaaaaggggaattatattttgagtgctggtgtagac
aagacaacaataatttgggacgctcacacaggagaagccaaacaacagtttccttttcat
tcagcacctgcccttgatgtggactggcagaacaacactacctttgcctcatgcagcaca
gacatgtgcattcatgtgtgcaggcttggctgtgatcgcccagtcaaaaccttccaagga
catactaatgaggtcaatgctatcaaatgggatccttctggaatgttactagcctcctgc
tctgatgacatgacattaaagatctggagtatgaagcaggatgcatgtgtccatgacctc
caggctcacagcaaagagatatataccatcaagtggagtcccacaggaccagccaccagc
aacccgaactccaacatcatgttagcaagtgcttcatttgactctacggttcgactgtgg
gatgtggagcgaggtgtttgcatccacactctgaccaagcatcaggagcctgtctatagt
gtagcgttcagccccgacgggaagtatttggccagtggatcttttgacaagtgtgtccat
atctggaatactcagagtggaagtctcgtccacagctaccgaggaacaggcggcatattt
gaggtgtgctggaatgctcgaggagacaaagtgggtgccagcgcatctgatggctccgtc
tgtgttttagatctccgaaagtaa

DBGET integrated database retrieval system