KEGG   Mus musculus (house mouse): 214523
Entry
214523            CDS       T01002                                 
Symbol
Tmprss4, CAP2, mCAP2
Name
(RefSeq) transmembrane protease, serine 4
  KO
K09635  transmembrane protease serine 4 [EC:3.4.21.-]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    214523 (Tmprss4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    214523 (Tmprss4)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-
     214523 (Tmprss4)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   214523 (Tmprss4)
SSDB
Motif
Pfam: Trypsin SRCR_2 Trypsin_2 DUF1986 Hepsin-SRCR SRCR Ldl_recept_a
Other DBs
NCBI-GeneID: 214523
NCBI-ProteinID: NP_663378
MGI: 2384877
Ensembl: ENSMUSG00000032091
UniProt: Q8VCA5
Position
9:complement(45084024..45115417)
AA seq 435 aa
MESDSGQPLNNRDIVPFRKPRRPQETFKKVGIPIIAVLLSLIALVIVALLIKVILDKYYF
ICGSPLTFIQRGQLCDGHLDCASGEDEEHCVKDFPEKPGVAVRLSKDRSTLQVLDAATGT
WASVCFDNFTEALAKTACRQMGYDSQPAFRAVEIRPDQNLPVAQVTGNSQELQVQNGSRS
CLSGSLVSLRCLDCGKSLKTPRVVGGVEAPVDSWPWQVSIQYNKQHVCGGSILDPHWILT
AAHCFRKYLDVSSWKVRAGSNILGNSPSLPVAKIFIAEPNPLYPKEKDIALVKLQMPLTF
SGSVRPICLPFSDEVLVPATPVWVIGWGFTEENGGKMSDMLLQASVQVIDSTRCNAEDAY
EGEVTAEMLCAGTPQGGKDTCQGDSGGPLMYHSDKWQVVGIVSWGHGCGGPSTPGVYTKV
TAYLNWIYNVRKSEM
NT seq 1308 nt   +upstreamnt  +downstreamnt
atggagtcagacagtggccaacccctcaacaaccgtgatattgttccctttcgcaaaccc
cgaaggccccaggagaccttcaaaaaggtggggatccccatcattgcagtgctgctgagc
ctgatagccctcgtgattgtggcccttctcatcaaggtgattctggataaatactacttc
atctgcggcagtcccctgaccttcattcagaggggccagttgtgtgacggccaccttgac
tgcgcctcaggggaggatgaggaacactgtgtcaaggacttccctgaaaagcccggagtg
gcagtccggctctccaaggacagatccaccctgcaggtgctggatgcagccacagggacc
tgggcctcagtctgtttcgacaacttcacagaagcactggccaagacagcctgcagacag
atgggctatgacagccagcccgctttcagagcagtggagatccgtccagatcagaacctc
cctgttgctcaagtcacaggaaacagccaggaacttcaggtgcagaatggaagcagatcc
tgcctctcaggctccctggtttccttgcgctgccttgactgtggaaagagcctgaagact
cctcgtgtggtgggtggggtggaggcccctgtggattcttggccgtggcaggtcagcatc
cagtacaacaagcagcatgtctgtggtgggagcatcctggatccccactggatcctcaca
gcagcccactgcttcaggaagtatcttgatgtgtcaagctggaaggtcagggcaggctca
aacatactgggtaactctccatccttgcctgtggccaagatcttcatcgctgaacccaat
cctctgtaccccaaagagaaggacattgcccttgttaagctgcagatgccactcacattc
tcaggctcagtcaggcccatctgcctgcccttctctgatgaggtgcttgtcccagccaca
ccagtctgggtcattggatggggctttacagaagaaaacggaggaaagatgtctgacatg
ctactgcaggcatcagtccaggtcattgacagcacacggtgcaatgcagaggatgcctac
gaaggggaagtgaccgctgagatgctgtgtgcaggtaccccacagggtggcaaggacacc
tgccagggtgacagtggtgggcctttgatgtaccattctgacaagtggcaggtagtaggc
atcgtgagctggggccatggatgcggcggcccaagtactcctggagtgtataccaaggtc
actgcctatctcaactggatctacaatgttcggaagtctgagatgtaa

DBGET integrated database retrieval system