KEGG   Mus musculus (house mouse): 216049
Entry
216049            CDS       T01002                                 
Symbol
Zfp365, AI839779, AV340892, DBZ, Su48, Znf365, talanin
Name
(RefSeq) zinc finger protein 365
  KO
K16737  protein ZNF365
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    216049 (Zfp365)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation proteins
   Nde1-Su48 complex
    216049 (Zfp365)
SSDB
Motif
Pfam: Exonuc_VII_L RBD-FIP zf-C2H2 Chal_sti_synt_N zf-C2H2_4 FUSC ZapB YjbH dCache_2
Other DBs
NCBI-GeneID: 216049
NCBI-ProteinID: NP_848794
MGI: 2143676
Ensembl: ENSMUSG00000037855
UniProt: Q8BG89
Position
10:complement(67721935..67748492)
AA seq 408 aa
MQQTTFEESRYHWQDSLENVAVCLPFRCPRCGDHTRFRSLSSLRAHLEFSHSYEERTLLT
KCSLLPSLKDTELLRSSELPKQGKVLRGHAKVTKQKSSYVNLYSISHGHSKDTKPFEMVA
ERPVSYVQTYTAVDIRADSLDAPCASPGLPTQDTKAAFEAHVREKFNRMVEAVDRTIEKR
IDKLTKELAQKTAELLEVRAAFAQLTQKKQEVQRRERALNKQVDVAVEMIAVLKQRLTES
EEELLRKEEEVVTFNHFLEAAAEKEVQGKARLQDFIENLLQRVELAEKQLEYYQSQQASG
FSCDTSEHMLTDIPSNRKPRCLSRGHQHSVCNHPEMRAHFHLKGRSYLKKAKDERAGMQP
AKAIHEPAESPREFFRPAKKGEHLGLSRKGNFRPKMAKKKPTAIVNII
NT seq 1227 nt   +upstreamnt  +downstreamnt
atgcaacagacgacttttgaggaaagccggtaccattggcaggactcgctggagaatgtc
gctgtgtgcctgccattccgctgcccgaggtgtggagaccataccagatttagaagcttg
tcatccttgagggcccatctggaattcagtcacagctacgaagagcggaccctcctgaca
aaatgcagcctcctgccctctctcaaggacacagagcttctcaggtcctcggaactcccg
aagcagggaaaagtactccggggccacgcaaaggtgaccaagcagaagtcgagctatgtt
aacttgtacagcatctcccacgggcactccaaggacacgaaaccctttgagatggtggca
gagaggcccgtgtcctatgtgcagacctacacggccgtggacatccgggctgactctctg
gatgctccctgcgccagccctggtctccccacccaagataccaaagctgctttcgaggct
cacgtccgagaaaagttcaatcgcatggtagaggccgtggacaggaccatcgagaagaga
atcgacaaactcaccaaagagttggcccagaaaaccgccgaactgttggaagtccgggca
gcctttgcgcagctgactcagaagaagcaggaggtccagaggagagagcgggccctgaac
aaacaggtagatgtggccgtggaaatgatcgcagtgctgaagcagcgtctgacggaatcc
gaggaggagctcctgaggaaagaggaagaagtcgtcacattcaaccatttcctggaggca
gcggctgagaaggaggttcaaggaaaagcgaggctccaggactttattgaaaatctgctg
caacgggtagaattggcggagaagcagttggaatattatcaaagccagcaagcctccggt
tttagctgtgacactagtgagcatatgctcacagacatcccatcgaacaggaagcccaga
tgcctaagccgagggcaccagcattctgtttgcaaccatcctgagatgagggcccatttc
catctgaaggggagaagctacctgaagaaagccaaggatgagcgagccgggatgcagccc
gccaaggccattcacgaaccggctgagtctccaagagaattcttcagaccagccaagaaa
ggggaacacctgggtctgagccggaaagggaatttcaggcccaaaatggctaaaaagaag
cctacagcaatcgtgaatatcatctag

DBGET integrated database retrieval system