KEGG   Mus musculus (mouse): 216850
Entry
216850            CDS       T01002                                 

Symbol
Kdm6b, 1700064E03Rik, BC038313, Jmjd3
Name
(RefSeq) KDM1 lysine (K)-specific demethylase 6B
  KO
K11448  lysine-specific demethylase 6B [EC:1.14.11.68]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    216850 (Kdm6b)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.68  [histone H3]-trimethyl-L-lysine27 demethylase
     216850 (Kdm6b)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   Histone demethylases
    216850 (Kdm6b)
SSDB
Motif
Pfam: JmjC
Other DBs
NCBI-GeneID: 216850
NCBI-ProteinID: NP_001017426
MGI: 2448492
Ensembl: ENSMUSG00000018476
Vega: OTTMUSG00000005979
UniProt: Q5NCY0
Structure
PDB: 
4EYU 4EZH 4EZ4

Position
11; 11 B3
AA seq 1641 aa
MHRAVDPPGARSAREAFALGGLSCAGAWSSCPPHPPPRSSWLPGGRCSASVGQPPLSAPL
PPSHGSSSGHPNKPYYAPGTPTPRPLHGKLESLHGCVQALLREPAQPGLWEQLGQLYESE
HDSEEAVCCYHRALRYGGSFAELGPRIGRLQQAQLWNFHAGSCQHRAKVLPPLEQVWNLL
HLEHKRNYGAKRGGPPVKRSAEPPVVQPMPPAALSGPSGEEGLSPGGKRRRGCSSEQAGL
PPGLPLPPPPPPPPPPPPPPPPPPPPLPGLAISPPFQLTKPGLWNTLHGDAWGPERKGSA
PPERQEQRHSMPHSYPYPAPAYSAHPPSHRLVPNTPLGPGPRPPGAESHGCLPATRPPGS
DLRESRVQRSRMDSSVSPAASTACVPYAPSRPPGLPGTSSSSSSSSSSNNTGLRGVEPSP
GIPGADHYQNPALEISPHQARLGPSAHSSRKPFLTAPAATPHLSLPPGTPSSPPPPCPRL
LRPPPPPAWMKGSACRAAREDGEILGELFFGAEGPPRPPPPPLPHRDGFLGPPNPRFSVG
TQDSHNPPIPPTTTSSSSSSNSHSSSPTGPVPFPPPSYLARSIDPLPRPSSPTLSPQDPP
LPPLTLALPPAPPSSCHQNTSGSFRRSESPRPRVSFPKTPEVGQGPPPGPVSKAPQPVPP
GVGELPARGPRLFDFPPTPLEDQFEEPAEFKILPDGLANIMKMLDESIRKEEEQQQQQEA
GVAPPPPLKEPFASLQPPFPSDTAPATTTAAPTTATTTTTTTTTTTQEEEKKPPPALPPP
PPLAKFPPPPQPQPPPPPPASPASLLKSLASVLEGQKYCYRGTGAAVSTRPGSVPATQYS
PSPASGATAPPPTSVAPSAQGSPKPSVSSSSQFSTSGGPWAREHRAGEEPAPGPVTPAQL
PPPLPLPPARSESEVLEEISRACETLVERVGRSAINPVDTADPVDSGTEPQPPPAQAKEE
SGGVAVAAAGPGSGKRRQKEHRRHRRACRDSVGRRPREGRAKAKAKAPKEKSRRVLGNLD
LQSEEIQGREKARPDVGGVSKVKTPTAPAPPPAPAPAAQPTPPSAPVPGKKTREEAPGPP
GVSRADMLKLRSLSEGPPKELKIRLIKVESGDKETFIASEVEERRLRMADLTISHCAADV
MRASKNAKVKGKFRESYLSPAQSVKPKINTEEKLPREKLNPPTPSIYLESKRDAFSPVLL
QFCTDPRNPITVIRGLAGSLRLNLGLFSTKTLVEASGEHTVEVRTQVQQPSDENWDLTGT
RQIWPCESSRSHTTIAKYAQYQASSFQESLQEERESEDEESEEPDSTTGTSPSSAPDPKN
HHIIKFGTNIDLSDAKRWKPQLQELLKLPAFMRVTSTGNMLSHVGHTILGMNTVQLYMKV
PGSRTPGHQENNNFCSVNINIGPGDCEWFAVHEHYWETISAFCDRHGVDYLTGSWWPILD
DLYASNIPVYRFVQRPGDLVWINAGTVHWVQATGWCNNIAWNVGPLTAYQYQLALERYEW
NEVKNVKSIVPMIHVSWNVARTVKISDPDLFKMIKFCLLQSMKHCQVQRESLVRAGKKIA
YQGRVKDEPAYYCNECDVEVFNILFVTSENGSRNTYLVHCEGCARRRSAGLQGVVVLEQY
RTEELAQAYDAFTLAPASTSR
NT seq 4926 nt   +upstreamnt  +downstreamnt
atgcatcgggcagtggaccctccaggggcccgctctgcacgggaagcctttgcccttggg
ggcttgagctgtgctggggcttggagctcctgcccaccccatcctcctccccgaagctca
tggctgcccggaggcagatgctctgccagcgttgggcagcccccactctcagctccttta
cccccatctcatggcagtagctccgggcaccctaacaaaccctattatgctcctgggaca
cccaccccaagaccccttcacgggaagttggaatccctacatggctgtgtccaggcattg
ctccgggagccagcgcagccagggttgtgggaacagcttggacagttgtatgaatcagag
cacgacagtgaggaagccgtatgctgctaccatagggcccttcgctatggaggaagcttc
gccgagctgggaccccggattggccgcttgcagcaggcccagctctggaactttcatgcc
ggttcctgtcagcacagagccaaggtcctgcctcccctggagcaagtctggaatttgctg
caccttgagcacaaacggaactatggggctaagcgagggggccctccagtgaagagatct
gctgaaccccccgtggtccagcctatgcctcctgcagccctctcaggcccctcaggagag
gagggccttagccctggaggcaagcgcaggagaggctgcagctctgaacaggctggcctt
cccccaggtctgccactccctccaccacccccacccccaccgcctccaccaccaccacca
ccccctccaccaccaccgctgcctggcctggctattagccccccatttcagctgactaag
ccagggctgtggaataccctgcatggagatgcttggggccccgagcgcaagggttcagcg
ccgccagagcgccaggagcagcggcactcgatgcctcattcatatccatacccagctccc
gcctactccgctcatccgcccagccatcggctggtccccaacacaccccttggtccaggt
ccccgacccccaggagcagagagccatggctgcctgcctgccacccgtccccccggaagt
gaccttagagagagcagagttcagaggtcgcggatggactccagcgtttcaccagcagca
tctaccgcctgcgtgccttacgccccttcccggccccctggcctccccggcaccagcagc
agcagcagcagcagcagtagcagtaacaacactggtcttcggggtgtggagccaagccca
ggcattcctggcgctgaccattaccaaaaccctgcgctggagatatcccctcaccaggcc
cgcctgggtccctccgcacacagcagtcggaaaccatttttgacggcccctgctgccacg
ccccacttatccctaccccctgggaccccatcatcccctccacccccatgtcctcgcctc
ttgcgccctccaccgccccctgcttggatgaagggctcagcctgccgtgcagcccgagag
gatggagagatcttaggggagctcttctttggtgctgagggacctccccgtcctcctccc
ccaccccttccccaccgtgatggcttcttggggcctccaaacccccgcttttctgtgggc
actcaggattcgcataaccctcccattcccccaaccaccaccagcagcagcagcagcagc
aacagccacagcagtagtcctactgggccggtgccctttccaccaccctcctatctggcc
agaagtatagaccccctccccaggccatccagcccaaccttgagcccccaggacccacct
cttccaccactgactcttgccctgcctccagcccctccctcctcctgccaccaaaatacc
tcaggaagcttcaggcgctcggagagcccccggcccagggtctccttcccaaagaccccc
gaggtggggcaggggccacccccaggccctgtgagtaaagccccccagcctgtgccacct
ggggttggagagctgcctgcccgaggcccgaggctctttgatttcccacccactccgctg
gaggaccagtttgaagagccagccgaattcaagatcctacctgatgggctggcaaacatc
atgaagatgctggatgaatccattcggaaggaggaggagcagcagcagcagcaggaggca
ggcgtggctcccccacccccactcaaagagccctttgcatctctacagcctccatttccc
agtgacacagccccagccaccaccactgctgcccccaccaccgccaccaccaccacaacc
accaccaccaccaccacccaagaagaggagaagaagccaccaccagccctaccaccacca
ccgcctctagccaagtttcctccacctccccagccacagcccccaccacctccaccagcc
agcccagccagcctgctcaaatcgttggcctctgttcttgagggacaaaagtactgttac
cgggggactggagcagccgtctcaaccaggcccgggtccgtgcccgccactcagtattcc
cctagtcctgcatcaggtgctaccgccccaccacccacttcagtggcccctagtgcccag
ggctcccccaagccctcggtttcctcgtcatctcagttctctacctcaggcgggccttgg
gcccgggagcacagggcgggtgaagagccagcaccaggccccgtgacccctgcccagttg
cccccacctctgccgctgccccctgctcgttctgagtctgaggtgctagaagaaatcagt
cgggcttgtgagacccttgtagagcgggtgggccggagtgccatcaacccagtggacacg
gcagacccagtggacagtgggactgagccacagccgccgcctgcgcaggccaaggaggag
agtgggggggtggcggtagcagcagcaggtccaggtagtggcaagcgtcgtcaaaaggag
catcggcggcacaggcgggcctgtagggacagtgtgggtcgacgaccccgcgaggggagg
gccaaggccaaggccaaggctcccaaagaaaaaagccgaagggtgctggggaacctcgac
ttgcagagtgaggagatccagggccgggagaaggcccggcccgatgtcggtggggtttcc
aaagtcaagacacccacagctccagcacccccgcctgctcctgcacccgctgctcagcca
acacccccatcagctcctgtccctgggaagaagactcgtgaggaggctccggggcctcca
ggtgtgagccgggcagatatgctgaagctccggtcacttagtgaggggcctcccaaggag
ctgaagatcaggctcatcaaggtggaaagtggggacaaggagacctttatcgcctctgag
gtggaagagcggcggctgcgcatggcagacctcaccatcagccactgtgccgccgatgtc
atgcgtgccagcaagaatgccaaggtgaaagggaaattccgagagtcctacctgtcccct
gcccagtctgtgaaacccaagatcaacactgaggagaagctgccccgggaaaaactcaac
ccccctacccccagcatctatttggagagcaaacgagatgccttctcgccggtcctgcta
cagttctgtacagacccccggaaccccatcaccgtcatcaggggcctggctggttcactt
cggctcaacttaggccttttctccaccaagactctggtggaggcgagcggtgaacatacg
gtggaggtccgtacccaagtacagcagccctcagacgagaactgggacctgacaggtacc
agacaaatctggccctgtgagagctcccgttcccacaccaccatcgctaaatacgcacag
taccaggcctcgtccttccaggagtcactgcaggaggagagggagagtgaggatgaggaa
tccgaggaaccagacagcactacaggaacctctcccagcagtgcaccggaccccaagaac
catcacatcatcaagtttggcactaacatcgacctgtctgatgccaagaggtggaagcca
cagctacaggagctgctgaaactgcccgccttcatgcgggtaacatccacaggcaacatg
ctcagccacgtgggccacaccatcctgggcatgaacaccgtgcagctatacatgaaggtc
cctggcagccgaacgccaggccaccaagagaataacaatttctgctcagtcaacatcaac
attggccctggggactgcgagtggttcgcggtacatgagcactattgggagaccatcagc
gccttctgcgaccggcatggtgtggactacttgactggttcctggtggccaatcttggat
gacctctatgcgtccaatattcctgtttaccgcttcgtgcagcgccctggagaccttgtg
tggattaatgcagggactgtacattgggtgcaggctaccggctggtgcaacaacattgcc
tggaacgtggggcccctcaccgcctatcagtaccagctggccctggagcgatatgagtgg
aacgaggtgaagaacgtcaagtccattgtgcccatgattcatgtgtcctggaacgtcgct
cgaacggtcaagatcagcgatcctgacttgttcaagatgatcaagttctgcctcctgcag
tcaatgaagcactgtcaggtacagcgggagagcctggtgcgggcagggaagaagatcgct
taccaaggccgtgtcaaagacgagcctgcctactactgcaacgaatgcgacgtggaggtg
ttcaacatcctgttcgttacaagtgagaatggcagccgaaacacgtacctggtgcactgc
gagggctgtgcgcgccgtcgcagcgcgggcctacagggcgtggtggtgctagagcagtac
cgcacggaggagctggcgcaggcctacgatgccttcacactggctcccgccagcacgtct
cgatga

DBGET integrated database retrieval system