KEGG   Mus musculus (house mouse): 216864
Entry
216864            CDS       T01002                                 
Symbol
Mgl2, CD301b
Name
(RefSeq) macrophage galactose N-acetyl-galactosamine specific lectin 2
  KO
K06721  C-type lectin domain family 10 member A
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mmu04054]
    216864 (Mgl2)
   04090 CD molecules [BR:mmu04090]
    216864 (Mgl2)
   04091 Lectins [BR:mmu04091]
    216864 (Mgl2)
Pattern recognition receptors [BR:mmu04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   216864 (Mgl2)
CD molecules [BR:mmu04090]
 Proteins
  216864 (Mgl2)
Lectins [BR:mmu04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   Asialoglycoprotein receptor (ASGR) subgroup
    216864 (Mgl2)
SSDB
Motif
Pfam: Lectin_N Lectin_C ATG17_like AIP3 ATG14 Baculo_PEP_C Crescentin DASH_Dad2 Exonuc_VII_L KASH_CCD Fez1 Gp58 Uso1_p115_C FapA FPP Tropomyosin_1 Filament Leu_zip SAM_KSR1 DUF2203 DUF5082 CALCOCO1 FH2 Fzo_mitofusin TPR_MLP1_2 NPV_P10 BLOC1_2 Jnk-SapK_ap_N FAP206 V_ATPase_I IFT57 Seryl_tRNA_N UL45 Tup_N Cytochrom_B562 Golgin_A5 Prefoldin_2 GAPT MPS2 DUF4164 Laminin_II Bacillus_HBL TMPIT
Other DBs
NCBI-GeneID: 216864
NCBI-ProteinID: NP_660119
MGI: 2385729
Ensembl: ENSMUSG00000040950
UniProt: Q8JZN1
Position
11:70020953..70028368
AA seq 332 aa
MTMRYENFQNLEREEKNQEMRNGDKKGGMESPKFALIPSQSFLWRILSWTHLLLFSLGLS
LLLLVVISVIGSQNSQLRRDLGTLRAILDNTTSKIKAEFQSLDSRADNFEKGISSLKVDV
EDHRQELQAGRDLSQKVTSLESTLEKREQALKTDLSDLTDHVQQLETDLKALTCQLANLK
NNGSEVACCPLHWTEHEGSCYWFSESEKSWPEADKYCRLENSHLVVVNSLEEQNFLQNRL
ANVLSWMGLTDQNGPWRWVDGTDFDKGFKNWRPLQPDNWHGHMLGGGEDCAHFSYDGRWN
DDVCQRHYHWICETELGKASSAHSPQLIASVP
NT seq 999 nt   +upstreamnt  +downstreamnt
atgacaatgagatatgaaaacttccagaacttggagcgggaagagaaaaaccaggagatg
agaaatggtgacaagaaaggaggaatggagtctccaaagtttgctctaattccttcccag
tccttcctgtggcgcatcctctcttggacccacctcctcctgttctccctgggcctcagc
ctcctgctactggtggtcatctccgtgattggatcccaaaattcccagttaaggagggac
ctaggcaccctaagagccattttagacaacaccacctccaagataaaggctgaattccag
tccctggactccagggctgacaacttcgaaaaagggatcagttctctgaaagtggatgtg
gaggatcacaggcaggaactgcaggcaggccgagacttgagccagaaggtgacttctctg
gagagcacactggagaagagggagcaggctctcaaaacagatctgtctgatttaaccgac
catgtacaacagctggagacagacttgaaggccttgacgtgccagctggccaacctcaag
aacaatggctcggaagtggcctgctgcccgcttcactggacggagcatgaaggcagctgc
tattggttctctgagtctgagaagtcgtggcctgaagctgacaagtactgccggctggag
aattctcacctggtggtggtcaactccctggaggagcagaattttctacagaatcgctta
gccaatgtgcttagctggatgggcctaacggaccaaaatgggccctggcgatgggtggat
gggaccgactttgacaaaggtttcaagaattggaggccactgcagccggataactggcat
ggacatatgctaggtggaggcgaggactgtgcccacttttcttacgatggtcgttggaat
gacgatgtctgccagaggcattaccattggatctgtgaaacagagctgggcaaagccagc
tcagcccactccccacaacttatagcctcagttccataa

DBGET integrated database retrieval system