KEGG   Mus musculus (mouse): 217837
Entry
217837            CDS       T01002                                 

Symbol
Itpk1, BC031182
Name
(RefSeq) inositol 1,3,4-triphosphate 5/6 kinase
  KO
K00913  inositol-1,3,4-trisphosphate 5/6-kinase / inositol-tetrakisphosphate 1-kinase [EC:2.7.1.159 2.7.1.134]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00562  Inositol phosphate metabolism
mmu01100  Metabolic pathways
mmu04070  Phosphatidylinositol signaling system
Module
mmu_M00132  Inositol phosphate metabolism, Ins(1,3,4)P3 => phytate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    217837 (Itpk1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    217837 (Itpk1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.134  inositol-tetrakisphosphate 1-kinase
     217837 (Itpk1)
    2.7.1.159  inositol-1,3,4-trisphosphate 5/6-kinase
     217837 (Itpk1)
SSDB
Motif
Pfam: Ins134_P3_kin Ins134_P3_kin_N RimK
Other DBs
NCBI-GeneID: 217837
NCBI-ProteinID: NP_766172
MGI: 2446159
Ensembl: ENSMUSG00000057963
Vega: OTTMUSG00000042332
UniProt: Q8BYN3
Position
12; 12 E
AA seq 419 aa
MQTFLKGKRVGYWLSEKKVKKLNFQAFAELCRKRGIEVVQLNLSRPIEEQGPLDVIIHKL
TDVILEADQNDSQSLELVHRFQEYIDAHPETIVLDPLPAIRTLLDRSKSYELIRKIEAYM
KDDRICSPPFMELTSLCGEDTMRLLEQNGLAFPFICKTRVAHGTNSHEMAIVFNQEGLNA
IQPPCVVQNFINHNAVLYKVFVVGESYTVVQRPSLKNFSAGTSDRESIFFNSHNVSKPES
SSVLTELDKIEGVFERPSDEVIRELSRALRQALGVSLFGIDIIINNQTGQHAVIDVNAFP
GYEGVSEFFTDLLNHIATVLQGQSTGGAATEEVAPLRHNRLLAEPAGSLAGERTCSASPG
CCGSMKGQDTPWKTETEAGNMGAGASAKLPHQRLGCTTGVSPSFQQHCVASLATKASSQ
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgcagaccttcctgaaagggaagagagttggctactggctgagcgagaagaaagtcaag
aagctcaatttccaggccttcgcggagctgtgcaggaagcgagggatagaagtcgtgcag
ctgaacctcagcagaccgattgaggagcagggccccctggacgtcatcatccacaagctg
accgatgtcatcctcgaggcagaccagaatgacagccagtccctggaattggtgcacagg
ttccaagagtacatcgatgctcaccctgagaccatcgtcttggatcccctccccgccatc
aggaccctgttagaccgttccaagtcctacgaacttatccgaaagatcgaggcctacatg
aaagatgacagaatctgctcgccgcctttcatggagctcacgagcctgtgtggggaggac
accatgaggctgctggagcagaacggcctggccttccccttcatttgcaaaaccagagtg
gctcatggaaccaactctcatgagatggctattgtgttcaaccaagagggcctgaatgcc
atccagcctccctgtgtggtccagaacttcatcaaccacaatgctgtcctgtacaaggtg
tttgtggtgggcgagtcctacacagtggtccagagaccctcactcaagaacttctctgcg
ggcacatcagatcgtgagtccatcttcttcaacagccacaatgtgtcaaagccggagtct
tcatcagtcctcactgagctggacaagatcgagggtgtgttcgaacggccaagcgatgag
gttatccgggagctgtcccgggctctgcggcaggcgctgggagtgtcactgtttggaatt
gacatcatcattaacaaccagaccgggcagcatgcagtcatcgatgtcaatgccttccca
ggctatgaaggagtgagtgagttctttaccgacctcctgaaccacattgccacagttctg
caaggccagagcacgggaggagctgccacggaggaagtggccccgctaaggcacaacagg
ctcctggcggaaccggcaggcagcctggctggggagcggacgtgcagtgccagccctggc
tgctgtggcagcatgaagggccaggacacaccctggaagactgagaccgaagcaggcaac
atgggcgctggtgcttccgccaagctgccgcaccagagacttggctgcaccactggcgta
tcacccagcttccagcagcactgtgtggcctctctggccaccaaggcttcctcacagtag

DBGET integrated database retrieval system