KEGG   Mus musculus (house mouse): 218100
Entry
218100            CDS       T01002                                 
Symbol
Zfp322a, Znf322, Znf322a
Name
(RefSeq) zinc finger protein 322A
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_jaz zf-C2H2_6 C1_4 zf-C2HC_2
Other DBs
NCBI-GeneID: 218100
NCBI-ProteinID: NP_001104577
MGI: 2442566
Ensembl: ENSMUSG00000046351
UniProt: Q8BZ89
Position
13:complement(23537273..23553378)
AA seq 410 aa
MENHLGENHRRCTLQKRNVTRELKKGKHTMYALKRVKKIYIRVHEITQIDNQTYQCLERE
QNFCENLARMCERTYTEEKPYRCDMCEKTFIQSSDLISHQRIHNYEKPYKCSKCEKSFWH
HLALSGHQRTHAGKKFYTCDICGKNFGQSSDLLVHQRSHTGEKPYLCNECDKCFSRSTNL
IRHRRTHTGEKPFKCLECEKAFSGKSDLISHQRTHTGERPYKCNKCEKSYRHRSAFIVHK
RVHTGEKPYKCGACEKCFGQKSDLIVHQRVHTGEKPYKCLECMRSFTRSANLIRHQATHT
HTFKCLEYEKSFNCSSDFIVHQRIHMEEKPHQWSMCESDFLLGMDFVAQQKMRAQTEELH
YKYSVCDKTFHHSSALLQHQTVHIDDEYICNMSEKGLDLSSHASETSRVS
NT seq 1233 nt   +upstreamnt  +downstreamnt
atggaaaaccacttaggagagaaccatagaagatgtacacttcagaagaggaatgtaacc
agagaactcaaaaaaggaaaacataccatgtatgccctcaaaagggtgaaaaagatttat
attcgtgtacatgagattactcaaatagataatcaaacatatcagtgccttgaacgtgaa
caaaacttttgtgaaaacttagcacgaatgtgtgagagaacatataccgaggagaaacct
tatagatgtgatatgtgtgagaaaaccttcatccaaagttcagatcttatttcccaccag
aggatccataattacgagaaaccttataagtgtagcaaatgtgagaagagcttttggcac
cacttagccctttcaggacaccagagaacacatgcaggtaaaaagttttatacctgtgac
atctgtggcaagaattttggtcagagctctgatctgcttgtccaccagcgaagccataca
ggtgaaaaaccttatctgtgtaatgagtgtgataaatgcttcagtcgaagtacaaatctc
ataaggcaccgaagaactcacacaggtgagaaaccgtttaagtgtctggaatgtgaaaaa
gcttttagtgggaaatcagatcttattagccaccaaaggactcataccggtgaaaggccc
tacaaatgcaataaatgtgagaaaagttaccgacaccggtctgccttcattgtgcataaa
agagttcatactggggagaagccgtacaagtgtggtgcctgtgagaagtgctttggccag
aaatcagaccttattgtacaccagagagtccatacaggagagaaaccatataaatgcttg
gagtgtatgagaagttttactcgaagtgccaacctaattaggcaccaggcaactcacact
catactttcaaatgccttgaatatgagaaaagtttcaactgtagctcagactttattgta
catcagagaattcatatggaagaaaaaccacatcaatggtctatgtgtgagagtgacttc
ctcctaggtatggacttcgttgcccagcagaaaatgagggctcaaacagaggagctccat
tataaatacagtgtatgtgataaaacctttcatcatagctcagcccttcttcaacatcag
acagtgcacattgatgatgaatacatctgtaacatgagtgaaaaagggcttgatctaagt
tctcacgcatcggaaacctcacgtgtgtcttga

DBGET integrated database retrieval system