KEGG   Mus musculus (mouse): 22165
Entry
22165             CDS       T01002                                 

Symbol
Txk, A130089B16Rik, Btk, Btkl, PTK, PTK-RL-18, PTK4, R, Rlk
Name
(RefSeq) TXK tyrosine kinase
  KO
K08016  tyrosine-protein kinase TXK [EC:2.7.10.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    22165 (Txk)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    22165 (Txk)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     22165 (Txk)
Protein kinases [BR:mmu01001]
 Non-receptor tyrosine kinases
  TEC family
   22165 (Txk)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_10 SH3_2
Other DBs
NCBI-GeneID: 22165
NCBI-ProteinID: NP_001116226
MGI: 102960
Ensembl: ENSMUSG00000054892
Vega: OTTMUSG00000054700
UniProt: P42682
Position
5 C3.2; 5 38.44 cM
AA seq 527 aa
MILSSYSSFQSVLCCCCCRCSVQKRQVRTQISLSREEELSEKHSQRQRPWFAKLMGKTQS
NRGGVQPSKRKPLPPLPQEPPDERIQVKALYDFLPREPGNLALKRAEEYLILERCDPHWW
KARDRFGNEGLIPSNYVTENRLANLEIYEWYHKNITRNQTERLLRQEAKEGAFIVRDSRH
LGSYTISVFTRARRHTQSSIKHYQIKKNDSGQWYITERHLFPSVPELIQYHQYNAAGLIS
RLRYPIGLLGSCLPATSGFSYEKWEIDPSELAFVKEIGSGQFGVVHLGEWRAHIPVAIKA
INEGSMSEEDFIEEAKVMMKLSHSRLVQLYGVCIQQKPLYIVTEFMENGCLLDYLRERKG
QLQKALLLSMCQDICEGMAYLERSCYIHRDLAARNCLVSSACVVKISDFGMARYVLDDEY
ISSSGAKFPVKWCPPEVFHFNKYSSKSDVWSFGVLMWEVFTEGKMPFENKSNLQVVEAIS
QGFRLYRPHLAPMTIYRVMYSCWHESPKGRPTFAELLQVLTEIAETW
NT seq 1584 nt   +upstreamnt  +downstreamnt
atgatcctgtcctcttatagctccttccagtctgttctctgctgctgctgttgccgctgc
tcagtacagaagagacaggtgagaactcagataagcctgagcagagaggaagaactctca
gaaaaacattcccagcgtcagaggccgtggttcgccaaactgatgggcaaaactcaatcc
aacagaggcggggtgcaaccctcgaagcgcaagccgctgccccccctcccgcaggagcct
ccagatgagagaatccaggtcaaggctctttatgacttcctgcctcgggagcctggtaat
ttggcactgaagagagcggaggaatatctgatattggagaggtgtgatcctcactggtgg
aaggccagagaccgcttcgggaatgaaggcttaatcccaagcaactatgtgacagaaaac
agactcgccaacttagaaatctatgaatggtaccacaagaacattacgagaaaccagacc
gaacgcctattgaggcaagaggctaaagaaggtgcctttatcgtgagagattcgagacac
ttggggtcttacacaatctctgtgtttacaagagctcgaaggcatacacagtcttcaata
aaacattatcagataaaaaagaatgactccggacagtggtacatcaccgaaagacatctc
ttcccctcagtccccgagttgatccagtatcaccagtacaatgcagctggtctcatatct
cgtctccgctatcccattgggctcctgggcagctgtttaccagccacatctggttttagc
tatgaaaagtgggagatagatccatcagagttggcttttgtcaaggagatcggaagtggt
cagtttggggttgtccacttaggagaatggagagcacatatcccggtcgccatcaaggcc
atcaatgaaggttccatgtctgaagaagacttcattgaggaagccaaggtgatgatgaaa
ctgtcacattcgaggttagttcaactttacggggtgtgtatacagcagaagcccctgtac
atagtgacggagttcatggagaacggctgcctgcttgactatctcagggagaggaaaggc
cagcttcagaaggcgctgctcttgagcatgtgccaagacatatgtgaagggatggcgtac
ctggagaggagctgctatattcacagggatctggctgccaggaactgtttggtcagttct
gcctgcgtagtaaagatctcagacttcggcatggcgaggtatgttttggacgatgaatat
atcagttcttctggagctaagttcccagtcaagtggtgcccacctgaagtctttcatttc
aacaaatacagtagcaagtctgatgtctggtcgttcggagttttaatgtgggaagttttt
acagaaggaaaaatgccttttgaaaataagtcaaatttgcaagtggtggaagccatttct
caaggtttccggctgtatcgtcctcacctggcccccatgaccatatacagagtgatgtac
agttgctggcatgagagccctaaaggccgtccgacatttgctgagctgcttcaggttctc
acggagatcgcagaaacgtggtga

DBGET integrated database retrieval system