KEGG   Mus musculus (house mouse): 223669
Entry
223669            CDS       T01002                                 
Symbol
Zfp7, KRAB20, KRAB7, Krox-2, Zfp-7, Zfp65, Zfp80, Zfp86-rs1, mszf73-2
Name
(RefSeq) zinc finger protein 7
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    223669 (Zfp7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    223669 (Zfp7)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    223669 (Zfp7)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB Zn-ribbon_8 zf_UBZ XPA_N zf-C2H2_6 zf-AN1 zinc_ribbon_15 HVO_2753_ZBP zf-C2H2_11 C1_4 zf-C2H2_jaz
Other DBs
NCBI-GeneID: 223669
NCBI-ProteinID: NP_001345745
MGI: 99208
Ensembl: ENSMUSG00000033669
Position
15:76763453..76776595
AA seq 685 aa
MEAVTFGDVAVHFSREEWQCLDSGQRALYKEVMLENHSSVAGLAGFLVFKPELISRLEQG
QEPWVLDLQGAEGTEAPRICQTDSAIRTDRKQTCEYTSLLQRQIPGFGDNLDSKVWSENC
PRSLGLSVSGSLFQKHRLNSEAVMPKNSTKDAVQERKELQATDVGYRPDDQRDHLSSKLI
RRQSVPTGENRYPCEECGKAFRWRSRLNQHKLSHTGEKSYQCNKCTKVFASSSRLIRHQR
AHTGEKPFKCDQCGKRFVLASVLTQHQRIHTGERPFKCAECGKGFHLSAKLVQHQRIHTG
EKPYRCEECGKTFGQSSSLVHHQRIHTGERPFICQECGKAFCQRSQLSRHRRTHTGERPY
SCQECGKAFCQRATLAQHQKMMHTAEKSQMPRASESPSLIACQGNTTEEKPFKCEQCGKA
FRWLSRLNQHQVVHSGEKPYQCNKCSKAFGCTSRLIRHQRTHTGEKPFKCDECGKRFVQS
SHLIQHQRIHTGEKPYVCDDCGRAFTQSSSLIYHQRIHKGEKPYKCSQCGKAFSMSTQLT
SHQRTHTGERPYTCNECGKTFRQNSTLFQHQIIHVRVKPYECNECGKAFSRSSYLIEHQR
IHTRAQGGHEFGDTPESPTVLNHKKVHTVKKLYQCDDCDKVFRWRSYLIIHQRIHTGERP
YKCNACGKAFHQIAKLTQHQKLHMR
NT seq 2058 nt   +upstreamnt  +downstreamnt
atggaggcggtgacctttggcgacgtggctgtgcacttctctcgagaggagtggcagtgt
ctggattctggtcagagggccctctacaaggaggtgatgctggagaaccacagcagcgtg
gcaggactagcaggattcctggtctttaagccggaattgatctcccggctggagcaagga
caagagccgtgggtccttgatctacagggagcagaggggacagaggcaccaaggatttgc
cagacagactccgctattagaactgatcgcaagcagacctgtgagtacacgagcctcctc
caaaggcagattcctggctttggagacaatttggattctaaggtctggtcagagaattgc
ccaagaagccttgggctaagcgtgagtggctcacttttccagaagcaccgtttgaatagc
gaggccgtgatgcccaagaactccacaaaggatgctgtccaagaacgtaaggagctgcag
gccaccgatgtgggttatcggcctgatgaccagagagaccacctgagctcaaaactgatt
cggcgtcaaagcgttcctaccggagagaaccgttacccatgtgaagagtgtggcaaagct
ttcaggtggcgctctcgcctgaatcagcacaaactgagccacactggagagaaatcttat
cagtgcaataagtgtacaaaagtcttcgcttctagctcgcgactgattcgccatcagaga
gctcacaccggagaaaagccgtttaaatgtgaccagtgtgggaagcgcttcgtcctggcc
tcggtactcactcagcatcagaggatccacaccggagagaggccatttaaatgtgccgag
tgcgggaaaggtttccacctgagcgcaaagctggttcagcatcaaagaattcatactgga
gagaagccttaccgatgtgaggagtgtgggaaaacctttggtcagagctcaagccttgtc
catcatcagagaatccacaccggagagaggcccttcatttgtcaagagtgcgggaaagcc
ttctgccagcgctcacagctcagcagacaccggaggacgcacactggagagaggccctac
tcctgccaggagtgtggcaaggccttctgccagagagcaactctagcccagcatcagaag
atgatgcatacagcggagaaatctcaaatgccgagagcctcagagagcccaagccttatt
gcctgtcagggaaataccactgaagagaagccatttaagtgtgagcagtgtggcaaagct
ttcaggtggctctctcgcctgaatcagcaccaggtggtccattctggagagaaaccttac
cagtgcaacaagtgctcgaaagcctttggctgtacctcacgactgattcgccaccagaga
actcacaccggagaaaagccctttaaatgtgacgaatgtggcaagcgcttcgtccagagc
tcacaccttattcagcatcagcgaatccacacgggagagaagccttacgtgtgtgatgac
tgtgggagagcttttacccagagctccagcctcatttaccaccagaggatccataaggga
gagaagccatataaatgcagccagtgtggcaaagccttcagcatgagcacacagctcacc
agccatcagaggactcacaccggggagagaccttatacgtgtaacgagtgtgggaagacc
ttccgtcaaaactcaacccttttccaacaccagataattcatgttagagtaaagccctat
gagtgtaatgagtgtggaaaggccttcagccggagctcataccttattgaacaccagaga
atacacactagagcccaggggggccatgaatttggggacacccctgaaagtcccaccgtt
ttgaaccataaaaaagtgcacactgtaaaaaagttgtaccagtgtgacgactgcgataag
gtcttcaggtggcgttcgtacctgattatccaccagcggattcacacaggagagaggcct
tataaatgtaatgcctgtggcaaggcttttcatcagatcgcaaagctcactcagcaccaa
aaacttcacatgagataa

DBGET integrated database retrieval system