KEGG   Mus musculus (mouse): 223690Help
Entry
223690            CDS       T01002                                 

Gene name
Ankrd54, C730048E16Rik, EST1068184, EST475269, Liar
Definition
(RefSeq) ankyrin repeat domain 54
  KO
K21442  ankyrin repeat domain-containing protein 54
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    223690 (Ankrd54)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    223690 (Ankrd54)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank Ank_4 Ank_2 Ank_5 Ank_3
Motif
Other DBs
NCBI-GeneID: 223690
NCBI-ProteinID: NP_659098
MGI: 2444209
Ensembl: ENSMUSG00000033055
Vega: OTTMUSG00000029926
UniProt: Q91WK7 A7YB12
Position
15 E1; 15 37.7 cM
AA seq 299 aa AA seqDB search
MAATGGGADDESRSGRSSSDGECAVAPEPLAEAGGLVSFADFGVSLGSGAGLPGRSVGRA
QSSLRYLQVLWQQDVEPRDELRCKIPAGRLRRAARPHRRLGPTGKEVHALKRLRDSANAN
DVETVQQLLEDGADPCAADDKGRTALHFASCNGNDQIVQLLLDHGADPNQQDGLGNTPLH
LAACTNHVPVITTLLRGGARVDALDRAGRTPLHLAKSKLNILQEGHSQCLEAVRLEVKQI
IHMLREYLERLGRHEQRERLDDLCTRLQMTSTKEQVDEVTDLLASFTSLSLQMQSMEKR
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggcagccaccggcgggggcgcggacgacgagtcgcgatccggccgctcgagctcggac
ggcgagtgcgcggtggcgccggagcctttggcggaagccggaggcctggtgtctttcgcg
gacttcggcgtttcgctgggcagcggcgccggcctcccgggccggtcggtgggcagggcc
cagtcctcgctgcgctacctccaggtcctgtggcagcaggacgtcgagcctcgcgacgaa
ctgcgttgcaagattcccgccgggcggttgaggcgtgccgccaggccccaccgtcggctc
gggcccaccggcaaggaggtacacgctctgaagaggctgagggactctgccaatgccaac
gacgtagaaacagtgcagcagctgctggaagatggggcggatccctgcgcagcggatgat
aaaggcagaactgccctccattttgcttcctgcaatggcaatgaccagattgtgcagctg
ctcctggaccatggggctgaccccaaccaacaggatggtctgggcaacacgccattgcac
ctggcggcctgcaccaaccatgttcctgtcatcaccacactgcttcgaggaggggcccgt
gtagatgccctagacagagctggccgcacacccctacacctggccaagtcgaagctgaac
atcctacaggagggtcattcccagtgtctggaggccgtccgcctggaggtgaagcagatc
atccacatgctacgcgagtacctggagcgcctggggcggcatgagcagcgagaacggcta
gatgacctctgcacccgcctccagatgacaagtaccaaagaacaggtggatgaagtgacg
gacctcttggccagcttcacctccctcagtctgcagatgcagagtatggagaagaggtag

DBGET integrated database retrieval system