KEGG   Mus musculus (mouse): 22612
Entry
22612             CDS       T01002                                 

Symbol
Yes1, Ye, Yes, p61-Yes
Name
(RefSeq) YES proto-oncogene 1, Src family tyrosine kinase
  KO
K05705  tyrosine-protein kinase Yes [EC:2.7.10.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    22612 (Yes1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    22612 (Yes1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    22612 (Yes1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     22612 (Yes1)
Protein kinases [BR:mmu01001]
 Non-receptor tyrosine kinases
  SRC family
   22612 (Yes1)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    22612 (Yes1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 SH3_10 zf-RING_14 SH3_3 hSH3
Other DBs
NCBI-GeneID: 22612
NCBI-ProteinID: NP_001192061
MGI: 99147
Ensembl: ENSMUSG00000014932
Vega: OTTMUSG00000055350
UniProt: Q04736 Q3TJI7
Structure
PDB: 
5MTJ 2YT6

Position
5 B1; 5 17.33 cM
AA seq 541 aa
MGCIKSKENKSPAIKYTPENLTEPVSPSASHYGVEHATVAPTSSTKGASVNFNSLSMTPF
GGSSGVTPFGGASSSFSVVSSSYPTGLTGGVTIFVALYDYEARTTEDLSFKKGERFQIIN
NTEGDWWEARSIATGKSGYIPSNYVVPADSIQAEEWYFGKMGRKDAERLLLNPGNQRGIF
LVRESETTKGAYSLSIRDWDEVRGDNVKHYKIRKLDNGGYYITTRAQFDTLQKLVKHYTE
HADGLCHKLTTVCPTVKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTKV
AIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEFMSKGSLLDFLKE
GDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGENLICKIADFGLARLIE
DNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILQTELVTKGRVPYPGMVNREVL
EQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYFTATEPQYQPGEN
L
NT seq 1626 nt   +upstreamnt  +downstreamnt
atgggctgcattaaaagtaaagaaaacaaaagtccagccataaaatacacaccggaaaat
cttacagagcctgtaagcccaagtgccagtcattatggagtggaacatgctacagttgcc
ccgacctcttccacaaagggagcatcagttaattttaacagtctttccatgacacccttt
ggagggtcctcaggggtgactccttttggaggagcgtcttcctcattctcagtggtgtca
agttcatatcctacaggtttaacaggtggtgtcactatatttgtggccttgtatgattat
gaagctagaactacagaagacctttcctttaagaagggtgaacgatttcaaataattaac
aatacggaaggagactggtgggaagcaagatcaattgctaccggaaagagtggttatatc
cctagcaattacgtagtgcctgcagattccattcaggcagaagaatggtattttggcaaa
atggggagaaaagatgcggaaagattacttctgaatcctgggaatcagcgaggtattttc
ttagtaagagaaagtgaaactactaaaggtgcttactccctctcaatccgtgattgggat
gaggtgaggggtgacaatgtgaagcattacaagatcagaaaacttgacaatggtggctac
tacatcacgaccagagctcagtttgatacactgcagaagctggtgaagcactacacagaa
catgctgatggattatgccacaagttaacaactgtgtgtcctactgtgaaaccccagact
caaggtctggcaaaagatgcttgggaaatccctcgagaatcattgcgactagaggtgaaa
ctaggtcaaggatgctttggggaagtgtggatgggaacatggaatggaactacaaaagta
gcaatcaaaacactaaagccaggtacaatgatgccagaagcattccttcaagaagctcag
ataatgaaaaagctaagacacgataaacttgttccactctatgcagttgtttctgaagag
cccatttatattgtcaccgagtttatgtcaaaaggaagcttgttagatttccttaaagaa
ggagatggaaagtatttgaagcttccacagctggttgatatggctgctcagatcgctgat
ggcatggcgtatattgaaagaatgaactatattcaccgagatctccgagctgctaatatt
cttgtaggagaaaatcttatatgcaaaatagcagattttggcttagcaagattaattgaa
gacaatgaatacacggcaagacaaggtgcaaaatttccaatcaagtggacagctcctgag
gctgctctgtatggtcgatttacaataaagtcagatgtgtggtcatttggaattctacag
acagagctggtaacaaaaggaagagtgccatatccaggtatggtaaaccgtgaagtattg
gaacaagtagagcggggatacagaatgccttgcccccagggctgtcccgaatccctccat
gaattgatgaatctttgctggaagaaggatcctgatgaaagaccaacatttgaatatatt
cagtccttcttggaagactacttcactgctacagagccacagtaccaaccaggagaaaat
ttataa

DBGET integrated database retrieval system