KEGG   Mus musculus (mouse): 226359
Entry
226359            CDS       T01002                                 

Symbol
C1ql2, Adii, BC040774, CTRP10
Name
(RefSeq) complement component 1, q subcomponent-like 2
  KO
K23284  C1q-related factor
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    226359 (C1ql2)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    226359 (C1ql2)
SSDB
Motif
Pfam: C1q Collagen BclA_C
Other DBs
NCBI-GeneID: 226359
NCBI-ProteinID: NP_997116
MGI: 3032521
Ensembl: ENSMUSG00000036907
Vega: OTTMUSG00000049073
UniProt: Q8CFR0 A0A3B0J351
Structure
Position
1:120268312..120270903
AA seq 287 aa
MALGLLIAVPLLLQAAPPGAAHYEMLGTCRMICDPYSVAPAGGPAGAKAPPPGPSTAALE
VMQDLSANPPPPFIQGPKGDPGRPGKPGPRGPPGEPGPPGPRGPPGEKGDSGRPGLPGLQ
LTTSAAGGVGVVSGGTGGGGDTEGEVTSALSAAFSGPKIAFYVGLKSPHEGYEVLKFDDV
VTNLGNHYDPTTGKFSCQVRGIYFFTYHILMRGGDGTSMWADLCKNGQVRASAIAQDADQ
NYDYASNSVVLHLDSGDEVYVKLDGGKAHGGNNNKYSTFSGFLLYPD
NT seq 864 nt   +upstreamnt  +downstreamnt
atggcactggggctgctgatcgcggtgcctctgctgctgcaggcggcgccccccggagcg
gctcactacgagatgctgggcacctgccgcatgatctgtgacccatacagcgtcgctccc
gcagggggacccgcgggcgccaaggctccaccgccgggacccagtaccgctgccctggaa
gttatgcaggacctcagcgccaaccccccgcctccgtttatccagggaccaaagggtgat
ccggggcgaccaggcaagccagggcctcggggtcctcctggagagccagggcctcctggg
cccaggggtcccccgggagagaaaggagactcggggaggccagggctacccggactgcag
ttgacaaccagcgcggccggtggcgttggagtggtgagtggcggaaccgggggcggtggc
gacacggagggagaagtgaccagtgcgctgagcgccgccttcagcggtcccaagatcgcc
ttctacgtgggactcaagagcccccacgaaggctacgaggtgctcaagttcgacgacgtg
gtcaccaatcttggcaatcactacgaccccactacaggcaagttcagctgccaggtgcgg
ggcatctacttcttcacgtaccacattctcatgcgtggcggcgacggaaccagcatgtgg
gcggatctctgcaagaacgggcaggtgcgagccagcgccatagcccaggacgcggaccag
aattacgactacgccagcaacagcgtggtactgcacctggattcaggcgatgaagtctac
gtgaagctggacggcgggaaggctcacggcggcaacaataacaagtacagcacgttctcg
ggcttcctcctgtatccggattag

DBGET integrated database retrieval system