KEGG   Mus musculus (mouse): 226442
Entry
226442            CDS       T01002                                 

Symbol
Zfp281, Znf281
Name
(RefSeq) zinc finger protein 281
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 FYVE
Other DBs
NCBI-GeneID: 226442
NCBI-ProteinID: NP_001153723
MGI: 3029290
Ensembl: ENSMUSG00000041483
Vega: OTTMUSG00000022094
UniProt: Q99LI5
Position
1; 1 E4
AA seq 893 aa
MKIGSGFLSGGGGPSSSGGSGSGGSSGSASGGSGGGRRAEMEPTFPQSMVMFNHRLPPVT
SFTRPAGTAAPPPQCVLSSSTSAAPAAEPPPPPAPDMTFKKEPAASAAAFPSQRTSWGFL
QSLVSIKQEKPADPEEQPSHHHHHHHHYGGLFAGAEERSPGLGGGEGGSHGVIQDLSLLH
QHAQQQPAQHHRDVLLSSGSRTDEHGNQEPKQDANVKKAKRPKPESQGIKAKRKPSASSK
PLVGEGEGAVLSPSQKPHICDHCSAAFRSSYHLRRHVLIHTGERPFQCSQCSMGFIQKYL
LQRHEKIHSREKPFGCDQCSMKFIQKYHMERHKRTHSGEKPYKCDTCQQYFSRTDRLLKH
RRTCGEAIAKGAASAEPGSSNHNSMGNLAVLSQGNTSSSRRKSKSKSIAIENKEHKTGKT
NESQMSNNINMQSYSVEMPTVSTSGSIIGTGIDELQKRVPKLIFKKGSRKNADKSYLNFV
SPLPDVVGQKSLSGKPGGSLGIVSNNSVETISLLQSTSGKQGPISSNYDDAMQFSKKRRY
LPTASSNSAFSINVGHMVSQQSVIQSAGVSVLDNEAPLSLIDSSALNAEIKSCHDKSGIP
DEVLQSILDQYSGKSETQKEDPFNLTEPRVDLHTSGEHSELVQEENLSPGTQTPSNDKTS
MLQEYSKYLQQAFEKSTNAGFTLGHGFQFVSLSSPLHNHTLFPEKQIYTTSPLECGFGQS
VTSVLPSSLPKPPFGMLFGSQPGLYLSALDATHQQLTPSQELDDLIDSQKNLETSSAFQS
SSQKLTSQKEQQKNLESSTSFQIPSQELASQIDPQKDIEPRTTYQIENFAQAFGSQFKSG
SRVPMTFITNSNGEVDHRVRTSVSDFSGYTNMMSDVSEPCSTRVKTPTSQSYR
NT seq 2682 nt   +upstreamnt  +downstreamnt
atgaaaatcggcagcgggttccttagcggcggcggcggtcccagcagtagcggtggtagc
ggctccggcggcagctccggcagcgccagcggcggcagcggcggcggcaggagagcagag
atggagcccaccttcccccagagtatggttatgttcaaccaccggcttcccccggtcacc
agcttcacccggccggcggggacggccgcccctcccccgcagtgcgtgttatcctcctct
acctccgcagccccggccgctgagcccccccctccgccagccccggacatgactttcaag
aaggagccggcggcgtcagccgcggccttcccttcgcagaggacctcctggggattcttg
cagtccttggtgagcatcaagcaggagaaacctgcggatcccgaggagcagccgtcccac
caccaccatcaccaccaccactatggggggctgttcgctggggctgaagagcgatcacca
ggcctaggaggaggggaaggggggagccacggcgtcatccaagacctcagtcttctgcac
cagcatgcccagcagcaaccggcccagcaccaccgcgatgtattactgagcagcggtagc
aggactgatgagcacggcaaccaggagccaaagcaggacgctaacgtcaaaaaggcaaag
aggccaaagccagaatctcagggaatcaaagccaagaggaagccaagtgcatcttccaaa
cctttggttggagagggagaaggtgccgtcctgtccccaagtcagaaacctcatatctgt
gatcactgtagtgctgctttcaggagctcctaccacctgcggagacatgtcctcatccac
acgggcgaaaggcctttccagtgcagccagtgtagtatgggtttcatccagaaataccta
ctgcagagacacgagaaaattcacagcagagagaaaccctttgggtgcgatcagtgcagc
atgaagtttattcagaagtaccatatggagagacacaagaggacacatagtggagaaaag
ccatacaagtgtgacacttgccaacagtatttttcaaggactgacagattgttgaagcac
aggcgcacgtgtggtgaagccatagcaaaaggagccgctagtgcagaacctgggtcatca
aaccataacagtatgggtaacctggctgtgttgtctcagggaaatacaagttcctcaagg
agaaagtcgaagtcgaaaagcatagctattgaaaataaggaacacaagactggcaaaaca
aatgaatcacaaatgtcaaacaatataaacatgcagagttattcagtagaaatgcctact
gtgtctaccagtgggagcataattggcactggaatagatgaactgcagaaaagggtgcca
aaattgatctttaagaaaggaagcagaaagaatgcagataaaagctaccttaattttgtg
tcaccgttaccagacgtagttgggcagaaatccttgtctggtaagccaggtggctcactt
ggcatcgtatcgaataatagtgtggagaccattagtcttctccaaagtacaagtggcaag
caaggcccgataagtagtaattatgatgatgccatgcagttttcaaagaagagaagatac
ctaccaactgccagcagcaacagtgccttttctatcaatgtaggacacatggtctcccag
cagtcagtcattcagtctgcaggggtcagtgttttggacaatgaggcgccattgtcactt
attgactcctcagctctaaatgctgaaattaagtcttgtcacgacaagtctggaattcct
gatgaggttttacaaagtattttggatcagtactctggcaaatcagaaacacagaaggag
gatcctttcaatttaacagaaccacgagtggatttacacacctcaggagaacactctgaa
ttggttcaagaagaaaatttgagcccaggcacccaaacaccttcaaatgataaaacaagc
atgttgcaagaatactccaaatacctccaacaggctttcgaaaaatccactaatgcaggt
tttactcttggacacggtttccaatttgtcagcttgtcttcacctctccacaaccacact
ttgtttccagaaaaacagatatacactacatctcctttggagtgtggttttggccagtct
gttacctcagtgctgccatcttcgttgccaaagcctccttttgggatgttgtttggatct
caaccaggtctttatttatctgctttggatgctacacatcagcagttgacaccttcccag
gagctggatgatctgatagattctcagaagaacttagagacatcatcagccttccagtcc
tcatctcagaaattgactagccagaaggaacaacagaaaaatttagagtcctcaacgagc
tttcagattccatctcaggagttagctagccagattgatcctcagaaagacatagagcct
agaacaacgtaccagattgagaactttgcacaagcattcggttctcagtttaagtcgggc
agcagggtgccaatgacctttatcactaactctaatggagaagtggaccatagagtaagg
acttcagtgtcagatttctcagggtatacaaatatgatgtctgatgtaagtgagccatgt
agtacaagagtaaagacacccaccagccagagttacaggtaa

DBGET integrated database retrieval system