KEGG   Mus musculus (mouse): 22715
Entry
22715             CDS       T01002                                 

Symbol
Zfp57, G19, Zfp-57
Name
(RefSeq) zinc finger protein 57
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    22715 (Zfp57)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    22715 (Zfp57)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    22715 (Zfp57)
SSDB
Motif
Pfam: KRAB zf-C2H2 zf-C2H2_4 zf-H2C2_2 DUF5810 zf-met
Other DBs
NCBI-GeneID: 22715
NCBI-ProteinID: NP_001013767
MGI: 99204
Ensembl: ENSMUSG00000036036
Vega: OTTMUSG00000037387
UniProt: Q8C6P8
Structure
PDB: 
4M9V 4GZN

Position
17 B1; 17
AA seq 421 aa
MAARKQSSQPSRTPVSYEDVAVSFTQEEWEYLTSTQKTLYQKVMSETFKNLTFVGSKKKP
QEPSSDLQDKNEEQEKSSSCTGVFKGGPFFFCLTCGKCFKKNTFLFNHQFPVRSRRLAVT
NPQSRKGKGYKAQHRGERPFFCNFCGKTYRDASGLSRHRRAHLGYRPRSCPECGKCFRDQ
SEVNRHLKVHQNKPAASNQAGNQASNQRLKSRVPPTTPRSQAPALKYVKVIQGPVARAKA
RNSGASTLNVRSNSITVVRSREKISCPYCHITFTMRTCLLTHLKIHFRRQPNQHFCCKES
AHSSNTLRMQKIYTCPVCDSSFRGKESLLDHLCCQRPIRFSKCWEILGHLLGYLHEPVVL
GNIFKVRDSSGKRMESRRRRRKRACTENPETEGLSGKGRVAPWEMEGATSPESPVTEEDS
D
NT seq 1266 nt   +upstreamnt  +downstreamnt
atggcagctaggaaacagtcttcccagccatccaggacaccagtcagttatgaggacgtg
gcagtgtctttcacccaggaagaatgggaatatcttacttctacacagaagaccctttac
cagaaagtgatgtcagaaaccttcaagaacctgacatttgtcggaagcaagaagaaacct
caagaacctagctcagatctgcaagataagaacgaggagcaggagaagtcctccagttgc
acaggggtattcaaaggtggaccattctttttctgtctgacctgtggcaaatgtttcaaa
aagaacaccttcctctttaatcaccagtttcctgtgaggtcccggaggctggcagtcaca
aatccacaaagccgcaaaggcaagggctacaaggctcagcatcgtggagagaggcctttc
ttttgtaatttctgtggcaagacttaccgtgatgcttctggactgagccgtcaccgacgt
gctcatttaggttataggccccgttcatgccctgagtgtggaaagtgtttccgggatcag
tctgaggtcaaccgtcacctgaaggtacaccaaaacaagccagcagctagcaaccaggct
ggcaaccaggctagcaaccagaggctgaagagtagggttccacctacaacacctagatcc
caagcgcccgccctcaagtatgtgaaagtgatccagggaccagtggccagggctaaggca
cggaacagcggagcctcgaccctgaatgtcagatccaactctattacagtggtccgttca
agagaaaagatctcttgtccctattgtcacataacgtttaccatgagaacctgtctctta
acccacctcaagatccacttcagacgtcaacccaaccagcacttctgctgcaaagagtcg
gcccactcatccaacacactcagaatgcaaaagatctacacttgccccgtctgtgacagc
tcctttaggggaaaggagagcctgctggatcacttgtgctgccaaagaccaatcagattc
agtaaatgctgggaaatcctgggtcatttgctcggctatcttcatgaacccgtggtgctg
ggaaatatttttaaagtaagggactcctcgggaaagaggatggaatccaggaggagaaga
cggaaacgtgcctgcactgagaatcctgaaacagaaggcctgtctgggaaaggtagggtg
gctccgtgggaaatggagggtgccaccagccctgagagtcctgtgacagaagaagattcg
gactga

DBGET integrated database retrieval system