KEGG   Mus musculus (house mouse): 22719
Entry
22719             CDS       T01002                                 
Symbol
Zfp61
Name
(RefSeq) zinc finger protein 61
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    22719 (Zfp61)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    22719 (Zfp61)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    22719 (Zfp61)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_jaz zf-met zf-C2H2_6 C1_4 Zn-ribbon_8 Zn_ribbon_SprT zf-LYAR HNH
Other DBs
NCBI-GeneID: 22719
NCBI-ProteinID: NP_033587
MGI: 99663
Ensembl: ENSMUSG00000050605
UniProt: Q923D1
Position
7:complement(23990470..24003273)
AA seq 555 aa
MEAVTFKDVAVVFTKEEFRLLDSAQRTLYQDVMVENFRNLLSVEYQLFKRDKPYLEREEK
PQMRRAAPRERDSGINGQSARGAVRGRGSPEALPCWQIWQWVTDDLTTSQNSVVNTPQLQ
GKAPCQSRPRPSAPVSVDENYIKSHTISVPIHSGRPPLPTLRAQGTSLTERQTRKDQYHQ
GSHRDEAGQRKRDAHPTSWIPRPRSDHRVCKSKGRCSPSDHGRDGVEVVPFDQNGGIHTR
QKSSQHREAVTDLSSSDPHQVLDSGGRACACVECGRGSPCGTDGCIHQGGRTGEERKEFG
HQRVCTPVKPYTCEQCGKVFTCRSALNVHVKVHTRERPYNCETCGSAFSQASHLQDHQRL
HTGEKPFKCDACGKSFSRSSHLRSHQRVHTGEKPYKCGECGKSFICSSNLYIHQRVHTGE
KPYKCVDCGKEFSRPSSLQAHQGIHTGEKSYVCTMCGKGYTLNSNLQVHLRVHTGEKPYS
CDVCGKGFSRSSQLQSHQRVHTGEKPYKCDVCGKSFGWRSNLIIHHRIHSSGKPYKSKRD
DKNIKESTQEKCSIK
NT seq 1668 nt   +upstreamnt  +downstreamnt
atggaggcagtaacattcaaggatgtggctgtggtcttcactaaggaggaattcaggctg
ctggactccgcccagaggacgctgtaccaagatgtgatggttgagaattttcggaacctg
ctctcagtggagtatcaacttttcaaacgagataaaccatacctggaaagagaagagaag
cctcaaatgaggagggcagccccgagggagagagattcagggattaacggtcagagtgcg
agaggagcagtccgagggagagggtcacctgaagcccttccctgctggcaaatctggcag
tgggtcacggacgacttaaccacgagtcaaaactctgtggtaaatactcctcagctacag
ggcaaggctccctgccagtccaggccaaggccatctgctcccgtttctgtagatgagaac
tatataaagagtcatacaataagtgttcccatccactccggaaggcccccacttcccact
ttgagagcccagggaacttccctgactgagcggcagactcggaaggatcagtaccaccaa
ggctcccacagagatgaagcgggtcagaggaaacgggatgctcaccctacaagttggatt
ccacgtccccgctctgatcacagagtatgcaaaagtaaggggcggtgtagccccagtgat
catgggagagacggggtggaagtggtgccattcgaccagaatggagggattcacactaga
cagaaaagctcccaacacagagaagccgttaccgatctctccagctcggatcctcaccaa
gtgttagactcaggagggagggcttgtgcatgtgttgaatgtgggagaggctccccttgt
ggcacagatggctgcattcatcaaggaggtcgcacaggagaagaacggaaggaattcggt
caccagagggtctgcacgccagtgaaaccgtacacctgtgagcagtgcggaaaagtcttt
acttgtagatcagcacttaatgtccacgtgaaagtgcacacgagggagagaccttacaat
tgtgagacctgcgggagtgccttcagccaggcctcccacctccaggaccaccagaggctc
cacactggggagaagccgttcaaatgcgatgcctgcggcaagagtttcagtcgcagttcc
cacctgcggtcccaccagagggtccacacgggagagaaaccatacaagtgcggggagtgt
gggaagagcttcatttgtagctccaatctctacatccatcagcgagtccacacaggagaa
aagccctataaatgcgtggactgcgggaaagaattcagtcgcccttcgagtcttcaggcc
catcagggcattcacaccggagagaaatcatacgtttgtactatgtgtgggaaaggctat
actctgaattcaaatctccaagtccacttgagagtccacacgggggagaagccgtacagt
tgtgacgtgtgtgggaaaggcttcagtcgctcttcacagctacagtcccatcagagagtc
cacacgggggagaagccttacaagtgtgatgtgtgtggtaagagctttggttggcggtca
aatcttataattcatcacagaatccacagcagtggtaaaccttacaagagcaagagagat
gataaaaacatcaaggagtccactcaggaaaaatgttctataaaatag

DBGET integrated database retrieval system