KEGG   Mus musculus (mouse): 22722
Entry
22722             CDS       T01002                                 

Gene name
Zfp64, Gm38422
Definition
(RefSeq) zinc finger protein 64
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-H2C2_5 zf-C2H2_4 zf-C2H2_jaz zf-C2H2_6 zf-met zf-C2H2_11 zf-C2H2_3rep BolA zf_C2H2_ZHX
Other DBs
NCBI-GeneID: 22722
NCBI-ProteinID: NP_001355988
MGI: 107342
Ensembl: ENSMUSG00000027551
Vega: OTTMUSG00000016118
Position
2 H3; 2 88.99 cM
AA seq 643 aa
MNASVEGDTFSGSMQIPGGTTVLVELAPDIHICGLCKQHFSNLDAFVAHKQSGCQLTTTP
VTAPSTVQFVAEETEPATQTTTTTISSETQTITVSAPEFVFEHGYQTYLPTESTDNQTAT
VISLPTKSRTKKPTAPPAQKRLGCCYPGCQFKTAYGMKDMERHLKIHTGDKPHKCEVCGK
CFSRKDKLKTHMRCHTGVKPYKCKTCDYAAADSSSLNKHLRIHSDERPFKCQICPYASRN
SSQLTVHLRSHTASVLENDVQKPAGLPAEESDAQQAPAVTLSLEAKERTATLGERTFNCR
YPGCHFKTVHGMKDLDRHLRIHTGDKPHKCEFCDKCFSRKDNLTMHMRCHTSVKPHKCHL
CDYAAVDSSSLKKHLRIHSDERPYKCQLCPYASRNSSQLTVHLRSHTGDTPFQCWLCSAK
FKISSDLKRHMIVHSGEKPFKCEFCDVRCTMKANLKSHIRIKHTFKCLHCAFQGRDRADL
LEHSRLHQADHPEKCPECSYSCSNPAALRVHSRVHCTDRPFKCDFCSFDTKRPSSLAKHI
DKVHREGAKTENRAPPGKDGPGESGPNHVPNVSTQRAFGCDKCGASFVRDDSLRCHRKQH
SDWGENKNSNLVTFPSEGIASGQVGPLVSVGQLESTLEPSHDL
NT seq 1932 nt   +upstreamnt  +downstreamnt
atgaacgcgagcgtggaaggagacaccttttctggatcgatgcaaatcccaggaggcacc
acggtgctggtggagctggcaccggacatccacatctgcggcctctgtaagcagcacttc
agcaatctggatgcctttgtggcccacaaacagagcggctgccagctgactaccacgccg
gtgacagcccccagcacggtccagtttgtggcagaggagacagagcctgccacccagacc
accacaacgaccatcagttcagagactcagactatcacagtttcagctccagagttcgtc
tttgaacatggctaccaaacttacctgcccacggagagcactgacaaccagacagccacc
gtgatctctctccccaccaagtcacgcaccaaaaagcccacagcaccccctgctcagaag
agactcggctgctgctatccaggttgccagttcaagaccgcctatggcatgaaggacatg
gagcgacacctgaagatccacaccggtgacaaaccccacaagtgtgaggtgtgcgggaag
tgcttcagccggaaggacaagctgaagacgcacatgcgctgccacacgggcgtcaagccc
tacaagtgcaagacgtgcgactacgcggcggcggacagcagcagccttaacaagcacctg
cgcatccactcggacgagcgacccttcaagtgccagatctgtccctacgccagtcgcaac
tccagccagctcaccgtgcacctgcgctcgcacacggcctctgtgctcgaaaacgatgtc
cagaaaccggcgggcctccctgctgaagaaagcgatgcccagcaggcccctgcagtcact
ctgtccttggaagcaaaggagagaacggccacccttggagaaaggacctttaactgccgc
tatccaggttgtcatttcaaaaccgttcatggcatgaaagatttggaccgccatctaaga
atccacacaggcgacaagccacacaagtgtgagttctgtgataagtgcttcagccggaag
gacaacctgaccatgcacatgcgctgccacacgagtgtgaagccacacaagtgccacctg
tgcgactacgcggccgtggacagcagcagcctcaagaagcaccttcgcatccactcggac
gagcggccctacaagtgccaactctgtccctacgccagccgcaactccagccagctcaca
gtgcacctgcgctcgcacacgggggacacccccttccagtgctggctctgtagcgccaaa
ttcaaaatcagctcggacttgaagcggcatatgatcgtgcattcaggggagaagcctttc
aaatgcgagttctgtgacgtccgttgcaccatgaaggcgaacctcaagtcccacatccgt
atcaagcacaccttcaagtgtctgcactgtgccttccagggccgggaccgggcagacctg
ctggagcacagtcgcctgcatcaggccgaccacccggagaaatgtcccgagtgtagctac
tcctgctccaacccagccgccctgcgcgtacacagcagagtccactgcacggaccggccc
ttcaaatgtgacttctgcagctttgatacaaagcggcccagcagcctggccaaacacatc
gataaggtgcacagagaaggcgccaagactgagaacagggcccctccgggcaaggatggt
cccggggagagcggtcccaaccacgtgcccaacgtcagcacccagagagccttcggatgc
gacaagtgcggtgcctcctttgtccgggatgactctctgaggtgccatcggaagcagcat
agtgactggggcgagaacaagaactcaaacctggtcactttcccctcagaaggcattgct
tccggacaggttggccccctggtctccgtggggcagctggagagcactctggagcccagc
catgacctctag

DBGET integrated database retrieval system