KEGG   Mus musculus (mouse): 22772Help
Entry
22772             CDS       T01002                                 

Gene name
Zic2, HPE5, Ku
Definition
(RefSeq) zinc finger protein of the cerebellum 2
  KO
K06235  zinc finger protein ZIC 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    22772 (Zic2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    22772 (Zic2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf_ZIC zf-C2H2 zf-H2C2_2 zf-C2H2_jaz zf-C2H2_6 zf-C2H2_4 zf-met zf-C2H2_8
Motif
Other DBs
NCBI-GeneID: 22772
NCBI-ProteinID: NP_033600
MGI: 106679
Ensembl: ENSMUSG00000061524
Vega: OTTMUSG00000020302
UniProt: F8VPV3
Position
14 E5; 14 65.97 cM
AA seq 529 aa AA seqDB search
MLLDAGPQFPAIGVGSFARHHHHSAAAAAAAAAEMQDRELSLAAAQNGFVDSAAAHMGAF
KLNPGAHELSPGQSSAFTSQGPGAYPGSAAAAAAAAALGPHAAHVGSYSGPPFNSTRDFL
FRSRGFGDSAPGGGQHGLFGPGAGGLHHAHSDAQGHLLFPGLPEQHGPHASQNVLNGQMR
LGLPGEVFGRSEQYRQVASPRTDPYSAAQLHNQYGPMNMNMGMNMAAAAAHHHHHHHHPG
AFFRYMRQQCIKQELICKWIDPEQLSNPKKSCNKTFSTMHELVTHVSVEHVGGPEQSNHV
CFWEECPREGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEK
PFQCEFEGCDRRFANSSDRKKHMHVHTSDKPYLCKMCDKSYTHPSSLRKHMKVHESSPQG
SESSPAASSGYESSTPPGLVSPSAEPQSSSNLSPAAAAAAAAAAAAAAAVSAVHRGAGSG
SSGSGGGSAAGSGGGGGGAGGGGGGSSGGGSGTTGGHSGLSSNFNEWYV
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgcttctggacgcggggccgcagttcccggccatcggggtgggcagcttcgcgcgccac
caccaccactcggccgcggcagcggcggctgcggcggccgagatgcaggaccgcgagctg
agcctggcggcagctcagaacggcttcgtggactcggccgcggcgcacatgggcgccttc
aagctcaaccccggggcacacgaactgtctcctggtcagagttcggcgttcacgtcgcaa
ggtccgggtgcttacccgggttcggctgctgcagccgctgcggccgcggctctagggccc
cacgccgcacacgttggctcctattcggggcctccctttaattccacccgggacttcctg
ttccgcagccggggcttcggggactcggcgccgggaggcgggcagcacgggctcttcgga
cccggcgccggcggccttcaccacgcgcactcggacgcgcagggccaccttcttttccct
ggcctcccggagcagcacgggccgcacgcctcgcagaacgtgctcaatgggcaaatgcgc
ctagggctgccgggcgaggtgttcgggcgctcggagcaataccgccaagtggccagcccg
cggaccgacccctactcggcggcgcagctccacaaccagtacggccctatgaatatgaac
atggggatgaacatggcagcggccgcagcccaccaccaccatcaccaccaccaccctggt
gcctttttccgctacatgcggcagcagtgcatcaagcaagagctcatctgcaagtggatc
gacccggagcagctaagcaatcccaagaaaagctgcaacaaaactttcagcaccatgcac
gagctggtgacccacgtctctgtggagcacgtcggcggcccggaacagagcaaccacgtc
tgcttctgggaggagtgtccacgcgagggcaaaccctttaaggccaaatacaaactggtc
aaccacatccgcgtgcacactggcgagaagcccttcccctgtcctttcccgggctgtggc
aaggtcttcgcacgctccgagaacctcaagatccacaaaagaactcatacaggggagaaa
cctttccagtgtgagttcgagggctgtgaccggcgcttcgccaacagcagcgacaggaag
aagcacatgcatgtccacacctcagataagccctatctctgcaagatgtgtgacaagtcc
tacacgcatcccagctcgttgcggaagcacatgaaggtccatgagtcctcccctcagggc
tccgagtcctccccggctgccagctctggctacgagtcgtccacacccccggggttggtg
tcccccagcgcagagccacaaagcagctccaacctgtccccagcagcggcggcagcagca
gcagcggctgcggcagcagcggccgcggtgtccgcagtgcaccgaggcgcgggttctggc
agcagcggctccggagggggctcggcggccggcagcggtgggggcggcggcggggcgggc
ggcgggggcggcggcagctctggcgggggcagcgggacaaccggaggccatagcggcctc
tcctccaacttcaatgaatggtacgtgtga

DBGET integrated database retrieval system