KEGG   Mus musculus (mouse): 22774
Entry
22774             CDS       T01002                                 

Symbol
Zic4
Name
(RefSeq) zinc finger protein of the cerebellum 4
  KO
K09225  zinc finger protein ZIC 4
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    22774 (Zic4)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    22774 (Zic4)
SSDB
Motif
Pfam: zf_ZIC zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_8 zf-C2H2_jaz zf-C2H2_11 zf-H2C2_5
Other DBs
NCBI-GeneID: 22774
NCBI-ProteinID: NP_033602
MGI: 107201
Ensembl: ENSMUSG00000036972
Vega: OTTMUSG00000038052
UniProt: Q61467 G3UYE7 Q8C8J4
Position
9:91247636..91271404
AA seq 334 aa
MKYKTSLVMRKRLRLYRNTLKESSSSCGHHGPQLAASSNPSVLPGLHEQPPQASHSRPLN
GLLRLGIPGDMYARSEPFAPGPMARSDTLATATALHGYGGMNLTMNLTAPHGPGAFFRYM
RQPIKQELICKWLGDDSPMSPRPCSKTFSTMHELVTHVTVEHVGGPEQANHICFWEECPR
QGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGEKPFRCEFEG
CERRFANSSDRKKHSHVHTSDKPYMCKVRGCDKCYTHPSSLRKHMKVHGRSPPPSSGYDS
AITSALASPSLESGREPSVACSAAVVVRGTDVSE
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgaaatacaagacttccctggtgatgaggaagcggttacggctgtacagaaacactctg
aaagaatcaagtagcagctgtggacaccatgggccccagctcgccgcttcttcgaacccc
tccgtgcttccgggccttcacgagcagcctcctcaggcctcccacagccgtcctttgaac
ggactcctgcgtctggggatccctggagacatgtatgcgaggtcggaaccttttgcacca
gggcctatggcccgcagcgacactctggcaacagccacagccctgcacggttatggcggc
atgaacctgaccatgaacctcaccgcaccccatggccctggagcctttttccgctatatg
cgccagcccatcaaacaggagctcatctgcaagtggctaggggatgacagcccgatgtcc
ccgcgtccctgctccaaaactttcagcaccatgcacgagctggtcacgcacgtcactgtg
gagcacgtcggtggcccagagcaggctaaccacatttgcttctgggaggagtgtccgcga
cagggcaagcccttcaaagccaaatacaaacttgtaaatcacatccgcgtgcacacgggc
gagaagcccttcccttgtcctttcccagggtgtgggaaggtctttgctagatcagaaaat
ctcaaaatacacaaacgaacacatacaggcgagaaacctttcagatgtgagttcgagggc
tgtgagaggcgtttcgccaacagcagcgaccgcaagaaacattcgcacgtgcacacgagc
gacaagccttatatgtgcaaggtgcgcgggtgtgacaagtgttacacgcaccccagctct
ctgcgaaagcacatgaaagttcatggtcgctcaccgccacccagctctggctacgactcg
gctataacgtctgctctcgcgtcgccctcgttagaaagcggccgtgagccctcagtggct
tgctctgcggcggtggttgtgcgtggcacagacgtgagcgaatga

DBGET integrated database retrieval system