KEGG   Mus musculus (house mouse): 22789
Entry
22789             CDS       T01002                                 
Symbol
Zp3r, AV264399, SP56
Name
(RefSeq) zona pellucida 3 receptor
  KO
K04002  complement component 4 binding protein alpha
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04610  Complement and coagulation cascades
mmu05133  Pertussis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    22789 (Zp3r)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05133 Pertussis
    22789 (Zp3r)
SSDB
Motif
Pfam: Sushi C4bp_oligo cEGF
Other DBs
NCBI-GeneID: 22789
NCBI-ProteinID: NP_033607
MGI: 104965
Ensembl: ENSMUSG00000042554
UniProt: Q0VET1 G3X970
Position
1:complement(130474847..130557371)
AA seq 579 aa
MITWSFIELWRTSHSTLFQMTLATVLMAPVLGDCGPPPLLPFASPTNQLYESTTFPSGTV
LKYTCHHGFKRVNSSHLSCDENGSWVYSTFCARKRCKNPGELVNGKVEIPSDLLVGSIIE
FSCSKGYLLIGSATSRCEVQGKGVDWSDSLPECVIATCEPPPPISNGKHSGRDDDLYTFG
SVVIYNCDPTFTLLGNASIVCTVVNRTVGVWRPHPPACQKIVCHRPQILKGYLAPGFRQF
YAYRDALEIRCKKGFILRGSSVIHCEANGEWFPSIPTCEPNGCTNIPDISYASWEGYKFP
LRNFEVFEIGAKLKYQCKPGYRASLNDPQTVTCQENLTWSSTNGCERICCPTPDMEKIKI
VSERRDFTGTCIYAYGDYVFYICNEGSYPMSTDGRSSCQADGKWDPAIPSCQADSGLQNR
LALFTFPNISETNVTNKTYLFGHEENSTEHAMKGVCLKPMVINGNLSVERVIYAELENIT
IQCDPGYTIVGSPNIICSNRTWYPEVPSCQMEVLEDCRIVSRGAQLLHCLSSPEDVHRAL
KVYKLFLEIERLEHQKEKWIQLHRKPQSMKINRSFRLCN
NT seq 1740 nt   +upstreamnt  +downstreamnt
atgataacctggtccttcattgagctgtggagaacctctcattcaactctgttccaaatg
accttggccactgttctgatggctcctgttcttggtgattgtggacctccacccctttta
ccgtttgcttctccaaccaaccagttgtatgagtcaacaaccttcccatctggaactgtc
ctgaaatatacctgccatcacggcttcaagagagtcaattcaagccatctttcttgtgat
gagaatggttcatgggtctatagtaccttttgtgccaggaaacgatgcaagaacccaggc
gagttggtcaatgggaaagtagaaattccatctgaccttttggtaggctcaatcatagag
ttcagctgctcaaagggctatcttctgattggctcagcaactagtcggtgtgaggtccaa
ggtaaaggagttgactggagtgattctctcccagaatgtgtaattgccacgtgtgagccc
cctccacccatcagcaatgggaagcacagtgggagagatgatgacctgtacacgtttggc
tctgtagtcatctacaattgtgatcccaccttcacactccttggcaatgcctccattgtc
tgcactgtggtgaacaggacagtaggtgtttggagaccacaccctcctgcctgtcaaaaa
atcgtctgccatcggccgcagattctgaagggatacttggcccctggatttcgacagttc
tatgcgtacagagacgctcttgagatccgatgcaagaagggttttatcctcagaggcagc
agtgtgatccactgtgaagcaaatggcgagtggtttccttctatccccacctgtgaaccc
aatggttgtaccaatataccagatatttcctatgcttcctgggagggatataagtttcca
ttaagaaattttgaagtatttgaaattggggccaaattgaaataccagtgcaagcctggt
tatcgagcaagtcttaacgatccccagactgtgacttgtcaggaaaatctgacttggtca
tctactaatggatgtgaaaggatatgttgcccaacaccagatatggagaaaatcaaaatt
gtgagtgaaaggagagatttcactggcacatgcatctatgcctacggagactatgttttc
tacatttgtaatgaaggctcttaccctatgtctacggatggaaggagttcatgtcaagca
gatggaaagtgggaccccgcaataccatcatgtcaggcagactcaggcctgcaaaaccgt
cttgctcttttcaccttcccaaacatatcagaaaccaatgtgacaaacaaaacctatcta
tttggtcatgaagaaaactcaaccgagcatgccatgaaaggtgtgtgtctcaaaccaatg
gtcataaatggaaacctgtctgtggagagagttatctatgctgaactggaaaatatcacc
attcaatgtgatcctggatataccatagttggttcaccaaacatcatttgttcaaacaga
acgtggtaccctgaggtacccagctgtcagatggaggtcctagaagactgcagaatagtg
agcagaggcgcacaactcttgcattgcctctcaagcccagaagatgtgcacagggccctg
aaggtgtacaagctgtttctagagatcgaacgattggaacatcagaaagagaagtggata
cagttacacaggaaacctcagtctatgaaaattaataggtcatttagactttgcaattag

DBGET integrated database retrieval system