KEGG   Mus musculus (house mouse): 231912
Entry
231912            CDS       T01002                                 
Symbol
Katnal1
Name
(RefSeq) katanin p60 subunit A-like 1
  KO
K07767  katanin p60 ATPase-containing subunit A1 [EC:5.6.1.1]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    231912 (Katnal1)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.1  Enzymes altering polypeptide conformation or assembly
    5.6.1.1  microtubule-severing ATPase
     231912 (Katnal1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Microtubule severing proteins
     231912 (Katnal1)
SSDB
Motif
Pfam: AAA KATNA1_MIT AAA_lid_3 Vps4_C RuvB_N AAA_16 TIP49 AAA_5 AAA_33 AAA_14 Mg_chelatase IstB_IS21 AAA_22 AAA_18 AAA_28 AAA_7 TsaE AAA_2 AAA_17 nSTAND3 RNA_helicase NACHT Parvo_NS1 PhoH CCDC22_CC AAA_25 AAA_30 Zeta_toxin AAA_24 SRPRB bpMoxR Guanylate_kin
Other DBs
NCBI-GeneID: 231912
NCBI-ProteinID: NP_705800
MGI: 2387638
Ensembl: ENSMUSG00000041298
UniProt: Q8K0T4
Position
5:complement(148808394..148865978)
AA seq 488 aa
MNLAEICENAKKGREYALLGNYDSSMVYYQGVIQQIQRHCQSLRDPATKAKWQQVRQELL
EEYEQVKSIVSTLESFKMDKPPDFPVSCRDEPFRDPAVWPPPVPAEHRAPPQIRRPNREV
RPLRKDVGAGARGLVGRAHQISKSDKPASRDKDYRARGRDDKARKNVQDGASDSEIPKFD
GAGYDKDLVEALERDIVSRNPSIHWDDIADLEEAKKLLREAVVLPMWMPDFFKGIRRPWK
GVLMVGPPGTGKTMLAKAVATECGTTFFNVSSSTLTSKYRGESEKLVRLLFEMARFYAPT
TIFIDEIDSICSRRGTSDEHEASRRVKSELLIQMDGVGGALENDDPSKMVMVLAATNFPW
DIDEALRRRLEKRIYIPLPTAKGRAELLKISLREVELDPDVHLEDIADKTEGYSGADITN
ICRDASLMAMRRRINGLSPEEIRALSKEELQMPVTRGDLELALKKIAKSVSAADLEKYEK
WMVEFGSA
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgaatttggcggagatttgtgagaatgcgaagaaaggccgggaatatgcgcttctggga
aattatgactcgtcaatggtgtattaccagggagtgatacagcagatccagagacactgc
cagtcactgagagacccggccaccaaagccaagtggcagcaggtacggcaggaactcttg
gaagaatatgaacaggttaagagtatcgtcagcactttagaaagctttaagatggacaag
ccccctgacttccccgtgtcttgccgagatgaaccgtttagagaccctgcagtatggcca
ccccctgtccctgcggaacacagagcaccccctcaaatcaggcgtccaaatcgcgaagtg
aggcctctgcggaaagacgtgggggcaggagcccggggactcgtgggccgagcacaccag
atatcgaagagtgacaaacctgcaagtcgggacaaggactatagagcaagagggagagat
gacaaggcaaggaaaaatgtgcaagatggtgcaagtgacagcgagattcccaagtttgat
ggcgccgggtatgataaggatctggtggaagccctggagagggacattgtgtccaggaac
cctagcattcactgggatgacatagcagacctggaggaggctaagaagttgctccgggaa
gctgttgtcctgcccatgtggatgcctgactttttcaaagggattagaaggccatggaag
ggtgtgctgatggttggccccccaggcactggtaagactatgctggctaaagcggttgcc
actgaatgtgggacaacctttttcaacgtgtcctcttctaccctgacatctaagtacaga
ggcgaatctgagaagttggtccgactgttgtttgaaatggctaggttctatgcccctacc
acgatcttcatcgacgaaattgattctatctgcagtcgaagagggacgtctgatgagcac
gaggcaagccgcagagtcaagtcggagctcctcatccagatggatggagttggaggagcc
ttagaaaatgatgacccatccaaaatggtgatggtcctggctgctacgaactttccgtgg
gacattgatgaggctctgcgcaggagactagagaaaaggatttacattcctctcccgaca
gcaaaaggaagagcggagctcctgaagatcagcctccgggaggtagagctggaccccgat
gtccacctggaggacatcgccgacaagacggagggctactcgggtgccgacatcactaac
atctgcagggacgcttctttgatggcgatgaggcggcgcatcaatggcttgagtccggaa
gagatccgggccctgtccaaggaggagctgcagatgcctgtcaccagaggggacttggag
ttggctctgaagaaaatcgccaagtctgtctcagcggcagacctggagaagtacgaaaag
tggatggttgagtttgggtctgcatga

DBGET integrated database retrieval system