KEGG   Mus musculus (mouse): 231912
Entry
231912            CDS       T01002                                 

Symbol
Katnal1
Name
(RefSeq) katanin p60 subunit A-like 1
  KO
K07767  katanin p60 ATPase-containing subunit A1 [EC:5.6.1.1]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    231912 (Katnal1)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.1  Enzymes altering polypeptide conformation or assembly
    5.6.1.1  microtubule-severing ATPase
     231912 (Katnal1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Katanin
     231912 (Katnal1)
SSDB
Motif
Pfam: AAA AAA_lid_3 Vps4_C AAA_16 RuvB_N AAA_2 AAA_33 AAA_5 TIP49 Mg_chelatase AAA_14 AAA_18 AAA_22 TsaE IstB_IS21 AAA_7 AAA_24 NACHT AAA_28 RNA_helicase PhoH AAA_17 Guanylate_kin AAA_25
Other DBs
NCBI-GeneID: 231912
NCBI-ProteinID: NP_705800
MGI: 2387638
Ensembl: ENSMUSG00000041298
Vega: OTTMUSG00000021231
UniProt: Q8K0T4
Position
5; 5 G3
AA seq 488 aa
MNLAEICENAKKGREYALLGNYDSSMVYYQGVIQQIQRHCQSLRDPATKAKWQQVRQELL
EEYEQVKSIVSTLESFKMDKPPDFPVSCRDEPFRDPAVWPPPVPAEHRAPPQIRRPNREV
RPLRKDVGAGARGLVGRAHQISKSDKPASRDKDYRARGRDDKARKNVQDGASDSEIPKFD
GAGYDKDLVEALERDIVSRNPSIHWDDIADLEEAKKLLREAVVLPMWMPDFFKGIRRPWK
GVLMVGPPGTGKTMLAKAVATECGTTFFNVSSSTLTSKYRGESEKLVRLLFEMARFYAPT
TIFIDEIDSICSRRGTSDEHEASRRVKSELLIQMDGVGGALENDDPSKMVMVLAATNFPW
DIDEALRRRLEKRIYIPLPTAKGRAELLKISLREVELDPDVHLEDIADKTEGYSGADITN
ICRDASLMAMRRRINGLSPEEIRALSKEELQMPVTRGDLELALKKIAKSVSAADLEKYEK
WMVEFGSA
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgaatttggcggagatttgtgagaatgcgaagaaaggccgggaatatgcgcttctggga
aattatgactcgtcaatggtgtattaccagggagtgatacagcagatccagagacactgc
cagtcactgagagacccggccaccaaagccaagtggcagcaggtacggcaggaactcttg
gaagaatatgaacaggttaagagtatcgtcagcactttagaaagctttaagatggacaag
ccccctgacttccccgtgtcttgccgagatgaaccgtttagagaccctgcagtatggcca
ccccctgtccctgcggaacacagagcaccccctcaaatcaggcgtccaaatcgcgaagtg
aggcctctgcggaaagacgtgggggcaggagcccggggactcgtgggccgagcacaccag
atatcgaagagtgacaaacctgcaagtcgggacaaggactatagagcaagagggagagat
gacaaggcaaggaaaaatgtgcaagatggtgcaagtgacagcgagattcccaagtttgat
ggcgccgggtatgataaggatctggtggaagccctggagagggacattgtgtccaggaac
cctagcattcactgggatgacatagcagacctggaggaggctaagaagttgctccgggaa
gctgttgtcctgcccatgtggatgcctgactttttcaaagggattagaaggccatggaag
ggtgtgctgatggttggccccccaggcactggtaagactatgctggctaaagcggttgcc
actgaatgtgggacaacctttttcaacgtgtcctcttctaccctgacatctaagtacaga
ggcgaatctgagaagttggtccgactgttgtttgaaatggctaggttctatgcccctacc
acgatcttcatcgacgaaattgattctatctgcagtcgaagagggacgtctgatgagcac
gaggcaagccgcagagtcaagtcggagctcctcatccagatggatggagttggaggagcc
ttagaaaatgatgacccatccaaaatggtgatggtcctggctgctacgaactttccgtgg
gacattgatgaggctctgcgcaggagactagagaaaaggatttacattcctctcccgaca
gcaaaaggaagagcggagctcctgaagatcagcctccgggaggtagagctggaccccgat
gtccacctggaggacatcgccgacaagacggagggctactcgggtgccgacatcactaac
atctgcagggacgcttctttgatggcgatgaggcggcgcatcaatggcttgagtccggaa
gagatccgggccctgtccaaggaggagctgcagatgcctgtcaccagaggggacttggag
ttggctctgaagaaaatcgccaagtctgtctcagcggcagacctggagaagtacgaaaag
tggatggttgagtttgggtctgcatga

DBGET integrated database retrieval system