KEGG   Mus musculus (mouse): 232339Help
Entry
232339            CDS       T01002                                 

Gene name
Ankrd26, 5730521P14Rik, BC008111, mKIAA1074
Definition
(RefSeq) ankyrin repeat domain 26
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: CCDC144C DUF3496 Ank_2 Ank_4 Ank_5 Ank Ank_3 Myosin_tail_1
Motif
Other DBs
NCBI-GeneID: 232339
NCBI-ProteinID: NP_001074581
MGI: 1917887
Ensembl: ENSMUSG00000007827
Vega: OTTMUSG00000048361
UniProt: D3Z482
Position
6; 6 F1
AA seq 1681 aa AA seqDB search
MKKIFGFRSKGPSPLGPSARPRSNCVGFGRESASGSHVPRYHIHDKDMGKIHKAASVGDV
AKVQHILILGKSGVNDRDKKDRTALHLACAYGHPEVVTLLVERKCEIDARDSESSTALIK
AVQCQEEECAAILLDHGADPNVMDSSGNTALHYAVYSENTSMAAKLLAHNANIEAKNKDD
LTPMLLAVKENKQHIVEFLVKKKASIHAVDQLGSNRQMFEYDGKRLQRSENSNPVDNGSE
DGSLTRSYNTPGPADSWPTSDEEDYNFDNKNVPKINLTELWTAAQQSRKNQTKCGFEELD
NGARFDDSDSPSESEDAIEVEPAPSVRVQTLSPSRQSPDPVEGATELAIEGEENGTDVIE
SASQEQPNHDNLTRADGWHKSNKSEMMSALGLGEDEDEHSPWDSESISESVSLKDVGHFS
GTADQTGKRRAHGQIEDVTYIPSCMSGSRSFKMAKLEESRNVGLPVAHMEAPRKYAIMEP
TIERRAPVLNKTETVGMTDAQTFKSEPESVSREEQTRLSGSEDSQQKVEEKRKYKNNEAE
PSGNLYSGAADGGADVKPQSGDTENQQSPREGSEGRGSGPALLMKEAKKMENEKWVSREP
ARTAMSERTGLPTGGWPQMQDGSCWSDTDQSEARPTKKTSSKHNKDSGQTAAVDNLDDFT
ESSETASEDHELQGPDSESILCAIEHLRLECKDTASLLKIRDAVYSYKRLIELKRSHCEL
LTGKLKRMENKYKGLQKEMSETEEVKSRLEHEKVGWEQELCRLRFALKQEEEKRRSADQL
SEKTSEQLRRKGEQCQSEVEARQQLEASLRTLEMELKTVKSHLNQVLEERNETQRQLSRE
QNARMLQDGILASHLCKQKEIEMTQKKMTSEVSVSHEKEKDLLHKNQRLQDEVAVLRLEM
DTIKSHNQEKEKRYLEDIKIANEKNDNLQRMVKLNEETFTKTIFQYTGQLNSLKAENTML
SSKLDNEKQNKERLETDVESFRSRLASALHDHAEIQTAKRDLEIAFQRARDEWFRVKDKM
NFDMSNLRDNNEVLSQQLSKTERKLNSLEIEFHHTKDELREKTLALKHAQRDLSQTQCQM
KEVEHMFQDEQGKVSKFMGKQESIEERLAQLQSENTLLRQQLDDAANKAESKDKTIVNIQ
DQFQDVLTRFQAESQRHSLRLEDRNQELVSECSHLRERLCQYENEKAEREVVVRQLQQEL
ADTLKKQSMSEASLEVSSRYRSNLEEEARDLKKKLGQLRSQLQEARDQHREAVHHAEKME
DHLQKLELEKSKFEITIKKQSEEIDQLQENLSRVNLSEEDKEKLQKLTELKESLECTVDQ
EQKRSSALEKELAEFKEVLKMTKKELNEYENRELNLRQDIKNNHLEMDIPVSTLIKKIDD
LTAKLETASSKCLHLGKKNQLLQQELLLMRTIQKKCGKLEKNKKQLEQEVVNLRSHMEKN
MVEHSQAQQYAREVEERARQDLVEKLKQVNLFLQAQAASQESLEQLRENSNASVRSQMEL
RIKDLESQLYRMKAQEDFDKIELEKYKQLYQEEFRARKSLSSKLNKTSEKLEEASSKLLL
EEQQNRSLLSTLSTRPVVECPCVGSFHNSLVFNRTLIPRENIVVPTSGLQPSNKRVEIYL
TKMHQELEKSINRELKEATAELESEFCRVSPLGSATKASQDQLSDASQEFIDILKKKYMI
C
NT seq 5046 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagatttttggcttcaggagtaagggcccatcgcccttaggcccctctgcccgc
ccgcgcagcaactgcgtgggctttggacgcgagagtgctagtggctcccacgtgcccagg
taccatattcacgacaaggatatgggcaagatccacaaggctgcaagcgtgggagatgta
gccaaagtgcagcatatccttatccttggaaaaagtggcgtgaacgatagagacaagaag
gacaggactgctctacatcttgcctgtgcttacggccacccagaagtggtgactctctta
gtagagagaaaatgtgagatagatgcccgtgacagcgagagcagcacggccctcattaag
gccgtgcagtgccaggaggaagaatgtgcagccatactgctggaccacggggccgatcca
aatgtgatggacagcagcggcaacaccgccctccactacgcggtctacagtgagaacacg
tccatggcagccaaactgctcgcacacaatgcaaacatagaagccaaaaacaaggatgac
ctaacacctatgttacttgctgtaaaggaaaataaacaacatattgtggaatttttagta
aagaagaaagcaagtattcacgcagttgatcagcttggaagcaacaggcaaatgtttgaa
tatgatgggaagagactacaaagatctgaaaacagcaatccagtggataatggttctgaa
gatggctctttaaccaggtcttataacacacctggccctgctgattcctggccgacatca
gatgaggaggactataactttgacaacaagaatgtccccaaaattaatttgacagagttg
tggacagctgctcagcagtctaggaaaaaccaaacaaaatgtggctttgaggagctagac
aatggagcccggtttgatgacagtgattcccctagtgaaagtgaagatgccattgaggtt
gagcctgcgccatcagtcagagtccagaccctctccccatcccgtcagtcacctgaccct
gtggaaggagcaaccgagctagcaattgaaggagaagaaaacggtactgatgttattgag
agcgcttcacaggagcaaccaaatcatgacaatttaacccgtgctgatggttggcacaaa
agtaataaaagtgaaatgatgtctgcattaggattaggagaagacgaagatgaacactcg
ccttgggattctgagagtatctccgagagtgtgtcactgaaagacgtaggtcacttctct
gggactgcagatcaaacgggaaaaaggagagcacatggacagatagaagatgtgacttat
ataccttcttgcatgagtggatcaagaagctttaaaatggctaaactagaggagtcaaga
aatgtaggccttccggtagcccacatggaggcccccaggaaatatgcaatcatggagcct
accatcgaaaggagggctcctgttctgaacaaaacggagacagtgggaatgacggatgca
cagactttcaagtcagagccagaatcagtatcaagagaagaacagacaaggctcagtggc
agcgaggacagccagcagaaggttgaagaaaagagaaaatacaaaaataacgaagcagaa
ccctcaggaaatctatacagcggtgctgctgacggcggtgctgatgtaaagccacagagt
ggagacactgagaaccagcagtctccccgggaggggagtgagggacgtggcagtggtcct
gccttgcttatgaaggaagcaaagaaaatggaaaatgaaaaatgggtatccagagagccc
gcgaggacggcaatgagtgagcgcaccggcttaccaactggtggctggccacaaatgcag
gatggttcctgctggagtgacacggaccaaagtgaagccaggcccacaaagaaaacatct
agtaaacataacaaggacagcgggcagacagctgcagtggacaaccttgacgactttact
gagtcgtctgaaacagcctctgaggaccatgagctccagggccctgattccgagagcatt
ttgtgtgcgatcgagcatctcagactggagtgtaaagatactgctagtctattgaaaatc
cgggatgccgtttattcatataaacgattaatagaacttaaaagaagccactgtgaacta
cttacaggaaaactgaaaagaatggaaaacaaatataagggattgcagaaggaaatgtca
gagacagaagaagtgaagtcacggttggaacatgaaaaggtcggatgggaacaggagctc
tgcaggctgagatttgcactgaaacaagaggaagagaagaggaggagtgcagaccagctt
tctgagaaaacctcggagcagcttagaaggaaaggcgagcagtgtcagagtgaggtggaa
gccaggcagcagcttgaagcctctctcagaaccctggagatggagctgaagacggtgaaa
agccatctcaaccaggtcttagaggaacgaaatgagactcagaggcagctctcccgagaa
cagaatgccagaatgttacaagatgggattcttgcaagtcacctctgcaagcaaaaggag
atagaaatgacgcagaagaaaatgacttctgaggtttctgttagtcatgaaaaagaaaaa
gatctattgcataaaaaccagaggctgcaggatgaagttgctgtgttacgactggaaatg
gacacaataaaaagccataaccaggagaaggaaaagaggtatcttgaggatattaagatt
gcaaatgagaagaatgacaaccttcaaaggatggtcaagctgaatgaagaaacatttaca
aaaaccatattccagtatactggacagcttaatagtcttaaagctgagaacacaatgctg
agttctaagctggacaacgaaaaacaaaataaggagagactggaaacagacgttgagtcg
ttccgatctaggctggcttctgctctgcatgatcacgctgaaattcagacagcaaaaaga
gacctagaaattgctttccagagagcgagagatgagtggtttcgtgtgaaagacaagatg
aatttcgatatgtctaacctccgagataacaatgaggttctctcccaacagctttctaaa
actgaaaggaagttgaatagcctagaaattgagtttcatcacacgaaagatgagcttcga
gagaagacgctggcgttaaagcatgcgcagagagacctgagccagacccagtgccagatg
aaggaggtggagcacatgtttcaggacgaacaaggcaaagtgagcaagttcatggggaag
caggagtccatagaggagaggctggcccagctgcagagtgagaacacgctgctccggcag
cagctggacgacgctgccaacaaggccgagagcaaagacaagaccatagtcaacatccaa
gaccagttccaggatgtgctaaccaggttccaagctgagagtcagcggcacagcctgagg
ctagaagacagaaaccaggagttagtcagtgagtgcagccatctaagagaaagactgtgt
cagtacgagaacgagaaagccgaaagagaggtagttgtgaggcaactccagcaagaattg
gctgataccctaaaaaagcagtcgatgtcagaggcttcgctggaagtctcctcccgctac
cgcagcaatttagaagaagaggcgcgagacttaaagaagaaattaggtcagctcagaagt
cagttgcaggaggcgcgggatcaacacagagaggctgtacaccatgctgagaagatggaa
gaccacctacaaaagcttgaacttgaaaaatccaagttcgaaattacaattaaaaagcaa
tcagaggaaattgatcaacttcaggaaaacctgtcaagggtgaatttgtctgaagaggat
aaggaaaaactgcagaaacttaccgagttgaaggagtctctggaatgtactgtggatcaa
gaacagaagagaagcagtgcgttagaaaaagaactggcagaatttaaggaagtcttaaaa
atgaccaaaaaagaattaaatgaatatgaaaacagagaacttaatcttcgtcaagatata
aaaaacaatcaccttgaaatggatatcccagttagtacactaataaaaaagattgatgat
cttacagcaaaactggaaactgcatcttcaaaatgtctacatctgggtaaaaaaaatcag
ctgcttcagcaggagttactattgatgaggactatacaaaagaagtgtgggaaactagag
aagaataaaaagcaattggagcaggaggtcgtgaacctcagaagtcacatggagaagaac
atggtggagcacagccaagcacagcagtacgcgcgggaggtcgaagagcgagcgaggcag
gacttggtggaaaagttaaaacaggtcaacctcttcctgcaggctcaagcagcatcccag
gagagcttggagcagttaagagagaacagtaacgcttcggttagaagtcagatggagctc
aggattaaagacctggagtcccagctctacagaatgaaagcccaggaagacttcgataaa
atagaactggaaaagtataagcagctctaccaggaagagttcagagctagaaaatcgctg
tcaagtaaactaaacaagaccagtgagaagctggaggaggccagcagcaagctgctcctg
gaggagcagcagaacaggtccttgctgagcactctgagtacaaggcctgttgtggagtgt
ccttgtgttggaagtttccataatagtttggtattcaacagaactcttattccaagagaa
aacatagtggttcctacttcaggcctacagccatcaaataagagagtggagatctacctg
accaagatgcatcaagagttggaaaaaagtataaatagagaacttaaagaagctactgct
gaacttgaatctgagttctgcagagtttctcccctgggatctgctactaaagcaagccaa
gatcaactctcagacgcatcgcaagaatttatagacattctaaagaaaaaatatatgatc
tgctga

DBGET integrated database retrieval system