KEGG   Mus musculus (house mouse): 232853
Entry
232853            CDS       T01002                                 
Symbol
Zfp954, 5730403M16Rik, 8030437F07
Name
(RefSeq) zinc finger protein 954
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    232853 (Zfp954)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    232853 (Zfp954)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    232853 (Zfp954)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_11 zf-C2H2_6 zf-C2H2_jaz zf-AN1 zinc_ribbon_15 zf-C2HE zf-met zf-MYND Zn-ribbon_8 C1_1 HypA Zn_Tnp_IS1595 DUF6076 zf_C2H2_ZHX DegT_DnrJ_EryC1
Other DBs
NCBI-GeneID: 232853
NCBI-ProteinID: NP_766326
MGI: 1917764
Ensembl: ENSMUSG00000062116
UniProt: Q7TNU5 Q8BIA9
Position
7:complement(7117682..7124475)
AA seq 416 aa
MATSQGPTILWSPMVIVEAAGGALPQVSQYSVKPANQEEGCVSFEDVAVYFSWEEWTLLD
DSQRLLYQTVMTEIFTLVSSLRLELSGIHDSTQVESCGDLSVPALRFLTPCLWTGCWIKV
ESETPPFNQSLSTEGGVSPSTLQQHMLCCAETPVLSTDNVTILQTSSGLLRHQVTSSGGD
TPTNTESGEAIQSEKKNCKCTYCGKIFTSISHLNRHWKIHTGEKPFQCTECGKSFSQKAF
LIKHFRMHTGEKPYRCSECGKAFKHNISLISHQGLHTGEMPFKCTECGKSYRSKEGLKVH
YRFHTGEMPFECSECGKSYRSREGLLNHFYSHTAEKPFSCGECGMYFTQNSELIEHLTVH
GKPFKCNECGRVFNSSYNFIRHMKVHVVAKQYACRECDKVYCSSSSLYKHRKIHAR
NT seq 1251 nt   +upstreamnt  +downstreamnt
atggcgacttcccagggccccaccatcctctggagcccgatggtgattgtggaggctgcg
ggtggagccctgccccaggtttcccagtattcagtgaaacctgccaaccaggaagagggc
tgcgtgtcctttgaggatgtggctgtgtacttctcctgggaggaatggacactgctcgat
gactctcaaaggctcctgtaccagactgtgatgacggagatcttcacactggtgtcttca
ctgagacttgaactttctgggattcatgattcaactcaggtggaatcttgtggagatctc
tctgtgcctgcactaagattcctgactccgtgtttatggacaggttgttggatcaaagtg
gagagtgaaacacccccctttaatcaaagcctgtccacagaaggaggtgtcagtccgtcc
acactgcaacagcacatgctgtgctgtgctgagacacccgtgctaagcacggacaatgtg
acgatcctccagacctcctcgggccttctcaggcatcaggtgacttccagtggtggggac
acccccacgaacactgagagtggagaggccattcagagtgagaagaagaactgcaaatgc
acttactgtggcaagatctttaccagtatatcccacctcaatcggcactggaagatacac
actggggaaaagccttttcagtgcaccgagtgtggcaagtccttcagccaaaaagccttt
ctcattaagcatttcagaatgcacaccggagagaaaccttataggtgcagtgagtgtggc
aaagccttcaagcataatatctcccttatttctcatcagggactccacacaggagagatg
ccttttaagtgcactgaatgtgggaaatcgtacaggagcaaagaaggccttaaggtccat
tatcgatttcatactggtgaaatgccctttgagtgtagtgaatgtggcaaatcgtacagg
agcagagagggccttctgaatcatttctacagtcataccgcggagaagcctttcagctgc
ggtgaatgtggcatgtatttcacccagaactccgagctcattgaacatctaacagttcac
ggcaagcctttcaagtgcaacgagtgtggacgagtcttcaattccagctacaacttcatt
agacacatgaaagtgcacgttgtagcaaagcagtatgcgtgcagggagtgtgacaaggtg
tactgcagtagctctagcctgtacaaacaccggaagattcacgctcgataa

DBGET integrated database retrieval system