KEGG   Mus musculus (mouse): 234358Help
Entry
234358            CDS       T01002                                 

Gene name
Zfp930
Definition
(RefSeq) zinc finger protein 930
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    234358 (Zfp930)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    234358 (Zfp930)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 KRAB zf-C2H2_11 zf-C2H2_jaz XPA_N Zn-ribbon_8 zf_UBZ zinc_ribbon_15 Zn_ribbon_SprT
Motif
Other DBs
NCBI-GeneID: 234358
NCBI-ProteinID: NP_001013397
MGI: 2675306
Ensembl: ENSMUSG00000059897
Vega: OTTMUSG00000062175
UniProt: A0A1D5RM15
Position
8; 8 B3.3
AA seq 441 aa AA seqDB search
MDALTYDDVHINFTPEEWALLDHTQRNLYTDVMLETYKNLVAIGYKPEDKIIEHLQNFRI
PGRHKGSLTREKPYEYTQCGKASTRHIGLQRHERIHTGEKPYKCNQCGKAFVDYCTLQKH
ERTHTGEKAYECNECGKGFTQQAYLQNHKRTHTGEKPYECYECGKGFAHYSTLRKHGSTH
TGEKPYECNECGKAFAQQSHLQNHKRTHTGEKPYECNECGKAFSQHSSLQNHKRTHTGEK
PYECNECGKAFSQYSNLRKHKRTHTGEKPYECNECGKAFSQHSSLQQHKRTHTGEIPYEC
NECGKAFSQHSSLQMHKRTHTGEKPYECKQCGKAFSQHSSLRKHKRTHTGQKPYECSQCG
KAFSRHSSLQQHKRTHTGEKPYECNECGKAFTQQGHLQKHKRTHTGEKPYECNQCGKAFS
EPSSLQMHKRTHNGEKLDVCN
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggacgcactgacatatgatgatgtccacattaatttcactccggaagagtgggccttg
ctggatcatacccagaggaatctctacacagatgtcatgctggagacctacaagaacctc
gttgctataggttacaaaccagaagacaaaattattgaacatcttcaaaattttagaata
cctggaaggcataaaggaagtcttaccagagagaaaccctatgaatatactcaatgtggt
aaagcctctacacgtcacattggtcttcaaaggcatgaaagaattcatactggagagaaa
ccttataaatgtaatcaatgtggtaaagcctttgtagattactgtactcttcaaaaacat
gaacgaacacatactggagagaaagcctatgaatgtaatgaatgtggtaaaggctttaca
caacaagcttacctccaaaaccataaaagaacacacactggagagaaaccctacgaatgt
tatgaatgtggtaaaggatttgcacattactctactcttcggaaacatggttctacacat
actggagagaaaccctatgaatgtaatgaatgtggtaaagcctttgcacaacagagtcat
ctccaaaaccataaaagaacacatactggagagaaaccctatgaatgtaatgagtgtggt
aaagccttttcacaacacagtagtctccaaaaccataaaagaacacatactggagagaaa
ccctatgaatgtaatgaatgtggtaaagctttttcacaatacagtaatctccgaaagcat
aaaagaacacatactggggagaaaccctatgaatgtaatgagtgtggtaaagccttttca
caacatagtagtctccaacaacataaaagaacacatactggagagataccttatgaatgt
aatgaatgtggtaaagccttttcacaacatagtagtctccaaatgcataaaagaacacat
actggagagaaaccctacgaatgcaagcaatgtggtaaagccttttcacaacacagtagt
cttcgaaagcataagagaacacatactggacagaagccctatgaatgtagtcaatgtggt
aaagccttttcacgacacagtagtctccaacaacataaaagaacacatactggagagaaa
ccttatgaatgtaatgagtgtggtaaagcctttacacaacagggtcatctccagaaacat
aaaagaacacatactggagagaagccctatgaatgtaatcagtgtggtaaagccttttcg
gaacccagcagtctccaaatgcataaaagaacacataatggagagaaactcgatgtatgc
aattaa

DBGET integrated database retrieval system