KEGG   Mus musculus (mouse): 235312
Entry
235312            CDS       T01002                                 

Symbol
C1qtnf5, Adie, Ctrp5, Mfrp
Name
(RefSeq) C1q and tumor necrosis factor related protein 5
  KO
K24212  complement C1q and tumor necrosis factor-related protein 5
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    235312 (C1qtnf5)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 C1q domain-containing proteins
  Adiponectin / short collagen group proteins
   235312 (C1qtnf5)
SSDB
Motif
Pfam: C1q Collagen BclA_C
Other DBs
NCBI-GeneID: 235312
NCBI-ProteinID: NP_001035721
MGI: 2385958
Ensembl: ENSMUSG00000079592
Vega: OTTMUSG00000020632
UniProt: Q8K479 Q4ZJN4
Position
9 A5.1; 9 24.62 cM
AA seq 243 aa
MRPLLALLLLGLVSGSPPLDDNKIPSLCPGQPGLPGTPGHHGSQGLPGRDGRDGRDGAPG
APGEKGEGGRPGLPGPRGEPGPRGEAGPMGAIGPAGECSVPPRSAFSAKRSESRVPPPAD
TPLPFDRVLLNEQGHYDPTTGKFTCQVPGVYYFAVHATVYRASLQFDLVKNGQSIASFFQ
YFGGWPKPASLSGGAMVRLEPEDQVWVQVGVGDYIGIYASIKTDSTFSGFLVYSDWHSSP
VFA
NT seq 732 nt   +upstreamnt  +downstreamnt
atgaggccacttcttgcccttctgcttctgggtctggtgtcaggctctcctcctctggac
gacaacaagatccccagcctgtgtcccgggcagcccggccttccaggcacaccaggtcac
catggcagccaaggcctgcctggccgtgacggccgtgatggccgcgacggtgcacccgga
gctccgggagagaaaggcgagggcgggagaccgggactacctggcccacgtggggagccc
gggccgcgtggagaggcagggcccatgggggctatcgggcctgcgggggagtgctcggta
cccccacgatcagccttcagtgccaagcgatccgagagccgggtacctccgccagccgac
acacccctacctttcgaccgtgtgctgctaaatgagcagggccattacgaccccactact
ggcaagttcacctgccaagtgcctggcgtctactactttgctgtgcacgccactgtctac
cgggccagcttgcagtttgatcttgtcaaaaacgggcagtccatcgcctctttcttccag
tattttggggggtggcccaagccagcctcgctctcagggggtgcgatggtaaggctagaa
cctgaggaccaggtgtgggtgcaggtgggcgtgggtgattacattggcatctatgccagc
atcaagacagacagtaccttctctggatttctcgtctattctgactggcacagctcccca
gtcttcgcttaa

DBGET integrated database retrieval system