KEGG   Mus musculus (mouse): 235633Help
Entry
235633            CDS       T01002                                 

Gene name
Als2cl, 79H19D, 79H19E, BC022645, D930044G19Rik, mRn.49018
Definition
(RefSeq) ALS2 C-terminal like
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: MORN VPS9 DUF1957 RhoGEF
Motif
Other DBs
NCBI-GeneID: 235633
NCBI-ProteinID: NP_001139531
MGI: 2447532
Ensembl: ENSMUSG00000044037
Vega: OTTMUSG00000025999
UniProt: Q60I26 A0A0R4J1X4
Position
9 F2; 9 60.79 cM
AA seq 952 aa AA seqDB search
MSSSEEADLLRLEEVFSTTLARTISLILQPLLLADPEPSDPCGKECLRLLQQLHESAQRL
WYVTEQSLLSLRQRLYHPPSKGLEAVLLLSNADHVLQAHMEYIKSYTDCVVAQAFQKVSK
KRSEFWRSQRKALRQLLSSGNSEGSVGTTMCQALRQPLSQHVQKYLLLLLSLRDTLDESH
PAQELVMHAITLFGNLQSFMGQALDQAVATQALWHSLSSRLRDVLCSPAHRLLQDSQDIP
VVVTPLRAERVLLFDDSLVLLQGHNTHTFDLKLVWVKPGQDKCVLHILTPEEEISFCTRD
PQGQVVWQWKVTQAVCQALCGKKDFPVLGSGRETSVPPECRCVAYTFRREGRLCQATYDG
EWCRAKPHGKGTLKWPDGRNHVGTFYQGLEHGFGICLVPQASEDKFDCYKCHWREGRMCE
YGICEYGTDEVYKGYFQAGLRHGFGILESAPQAPQPFRYTGHWERGQRSGYGIEEDRDRG
ERYIGMWQADQRHGPGVVVTQAGVCYQGTFQGDKMAGPGILLCEDDSLYEGTFTRDLTLL
GKGKVTFPNGFTLDGSFSSGTDKGLYTQGVLDTAALPPDPSSTRKRQLGLGTFPVESRWQ
GVYSPFRDFLRLGCPGEQQEALLGFHTQSSRELRKSQECLCCERSHPEDCVGSMEDTLKE
LLQHRKPKALQQYLRKALSNSRHPLGQLLRTLMLTFQATYSGIGANKHLQEMAQEEVKQH
ARELWAAYRGLLKVALQRQGQTLEEENMETRDLQVHGLLLPLILPSFYSELFTLYLLLHE
REDGLYSRGITNLSLFPDTKLLEFLDVQKHLWPLKDLKLTSNQRYSLVRDKCFLTATECL
QKIITTVHPREKLEVLEKTYGEIEATVSRVLGCKYKLPMDDLLPLLIYVVSRARIQHLGA
EIHLIRDMMDPVHTGGLHDFLLTALESCYEHIQKEDMRLHHLPGHWDARELW
NT seq 2859 nt NT seq  +upstreamnt  +downstreamnt
atgtctagctctgaggaggcagacctgctccggctggaggaggtcttctcaacgactctt
gctcgaaccatcagtctcatcctgcagcctctgctcttagctgacccggagccctcagat
ccctgtggcaaagagtgccttcggcttctgcagcagctgcatgagagtgcccagcggttg
tggtatgtgacagagcaaagcctgctttcgctgcggcagaggctataccacccaccttcc
aagggtctagaggccgtgctgttactgagcaatgctgaccatgtcctacaagcccacatg
gaatacatcaagtcctacactgattgcgtggtggcgcaagcttttcagaaggtctcaaag
aagaggagtgagttctggaggagccagcgcaaggcgctgaggcagctactgtcctctggg
aactctgagggctctgtgggcaccacgatgtgccaggccctccgccagccactctcccag
cacgtgcagaaatacttgcttctcctgctgagcctcagggacacccttgatgagagccac
ccggcccaggagctggtgatgcatgctatcaccctgtttggaaacctgcagtccttcatg
ggacaggccttggaccaagctgtggccacacaggccctgtggcacagcctcagcagccgg
ctgagggatgtgctctgcagccctgctcaccgactcttgcaggacagccaggacatcccc
gtggtggtcactccactgcgggctgagcgcgtgctgctctttgatgactcgcttgtcctg
ttgcagggccacaatacccacacgtttgacctgaagttggtgtgggtaaaacccggccaa
gacaagtgtgtgcttcatatcctcactcctgaagaagagatctccttctgcaccagagac
ccccagggccaggttgtctggcagtggaaggtgacccaggctgtgtgccaggccctctgt
ggcaagaaggacttccctgtgctgggatcaggccgggagacgtctgtgcctcctgaatgt
cgctgtgtggcctataccttccgccgagaggggcggctctgccaggctacctatgatggc
gagtggtgtcgagctaagccccatggcaagggaaccctgaagtggccagatgggcggaac
cacgtggggactttttaccagggcttggagcatggctttggcatctgcctggtgccccag
gcctctgaggacaagtttgactgttacaagtgccactggcgggaaggcaggatgtgtgag
tacggcatctgtgagtatggcactgacgaggtgtacaagggctattttcaggccggtctg
cggcacgggtttggcatcctcgagagtgccccacaggctccccagcccttcaggtacacg
ggccactgggagagaggccagaggagtggctacggcatcgaggaggacagggacaggggc
gagcgctacattggcatgtggcaggctgaccagcgtcatggccctggggtcgtggtcacc
caggcaggcgtctgctatcagggcacattccaaggggacaagatggctggcccaggcatc
ctgctctgcgaggacgactctctgtacgaaggtacttttaccagggacctgacgctccta
gggaagggcaaggtcaccttccccaatggttttaccttggatggttctttcagcagtggg
acagataaaggactgtacacacagggagtgctggacacggctgccctcccacctgaccca
agcagcacacgcaagagacagctgggactgggcaccttccctgtggagagccgctggcag
ggagtctacagccccttccgggacttcttgcgtttaggctgtcctggggaacagcaggaa
gccctcctgggcttccacacgcagagctccagggagctacgcaagtcccaggagtgcctg
tgttgtgagaggagccaccccgaggactgtgtgggcagcatggaagataccctgaaggag
ctgctgcagcaccgcaagcccaaggccctgcagcagtacctcaggaaggctctgagcaat
tcccgacaccccctggggcagctgctccgcaccctgatgctgaccttccaggccacatat
tcaggcatcggggccaacaaacacctgcaggagatggcccaggaggaggtgaagcagcat
gcccgggagctttgggctgcctacaggggtctactgaaggttgccttgcagcgccagggc
cagaccctggaggaggagaacatggagaccagggacctgcaggtgcacgggttgctcttg
cccctcatcctgcccagcttctactcagagctcttcacactgtacctgcttctccatgag
agagaggatggactgtacagccggggcatcaccaacctcagcctcttccctgacaccaag
ctgctggagttcctggatgtgcagaagcatctgtggcccctcaaggacctcaagctgaca
agcaatcagagatattctctggtccgggacaagtgtttcctgacggccactgagtgtctg
cagaagatcatcaccacagtgcaccctcgggagaagctggaggtacttgagaagacctat
ggggaaattgaggccacggtgtcacgggtgctgggctgcaaatacaaactgcccatggat
gacctattgccactgcttatctatgtggtgtcccgagctcgaattcagcatctgggagct
gagatccacctgatccgtgacatgatggatcccgtccacacaggtggcctccatgacttc
ctgctgacagctttagagtcctgttatgagcacatccagaaggaagacatgaggctgcac
catctgcccgggcactgggacgctagagaactctggtga

DBGET integrated database retrieval system