KEGG   Mus musculus (mouse): 23863Help
Entry
23863             CDS       T01002                                 

Gene name
Dand5, Cerl-2, Cerl2, Cerr2, Dte, GREM3, coco
Definition
(RefSeq) DAN domain family member 5, BMP antagonist
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: DAN Sclerostin Cys_knot
Motif
Other DBs
NCBI-GeneID: 23863
NCBI-ProteinID: NP_957679
MGI: 1344365
Ensembl: ENSMUSG00000053226
UniProt: Q76LW6 Q3UPN3
Position
8; 8 C2
AA seq 185 aa AA seqDB search
MFRSQFTTLLGLFSGAWLPTGSGRPGAPATPVQSGTAINQSWTLDPLVPISALGSWEAFL
GLQNKQQGTGELQGGGQRVAAGVPLPLAPQEVLQETCKALSFVQVISRPGCTSARVLNHL
CFGRCSSFYIPSSDPTPVVFCNSCVPARKRWTSVTLWCGAGQLASPRRVRISTVLVQKCQ
CRPKL
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgttccgtagccagttcaccacgctgctgggtctgttcagtggggcctggctacccaca
ggctcagggaggcctggggccccagcgacccctgttcagtccgggactgctatcaatcag
agctggactctggatcccctggtgcccatctctgccctgggtagctgggaggccttcctg
ggcctgcagaacaaacagcaggggacaggtgagctgcagggaggagggcagagagtagct
gctggtgtgcctttgcccttggctcctcaagaagtgcttcaggagacttgtaaagctctg
tcctttgttcaggtgatctccaggcctggttgcacaagtgcccgggtccttaatcatctc
tgttttggccgctgttcctccttctacattcccagctcggatcccacccctgtagtcttc
tgcaacagctgtgtgccggctcgaaagcgctggacatcggtgacgctgtggtgtggagct
ggccaattagcctcccctcggcgggtgaggatttccacggtattggtccagaagtgtcag
tgccgcccgaagctgtga

DBGET integrated database retrieval system