KEGG   Mus musculus (mouse): 240041
Entry
240041            CDS       T01002                                 

Gene name
Zfp945, A630033E08Rik, C730040L01Rik
Definition
(RefSeq) zinc finger protein 945
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 C1_1 zf-C2H2_11 Zn-ribbon_8 zf-H2C2_5 zf-met
Other DBs
NCBI-GeneID: 240041
NCBI-ProteinID: NP_001103724
MGI: 2445132
Ensembl: ENSMUSG00000059142
Vega: OTTMUSG00000032978
UniProt: Q66L36 Q3TGT7 F6WAU7
Position
17; 17 A3.3
AA seq 794 aa
MVKREETIVKNPETWKRAIRRMTASLVNAPQELLTFKEVAVDFSQEEWECLDCAQRALYM
DVMLENYNNLLFVENNHHVCVKHDEVLGQGSKYSAPEHVNIQEKSNKWKECGKMIHESSK
STPYQTNNRDASIESSNRHKTENAREPCKYKDCVNGLNLYPITCHNQTVYLEIKEHTKTL
YDEAFLSKYKLMLKGNNSGMKSHKCRKSGKFFTMTSSLSGHPRDHAREKPYQCTKCSKSF
LHLSHLQLHYKIHFGGYPYKCTECGKCFYHASGFERHCRIHATKNTYKCSFCSKSFICCS
GLRKHQKIHEENRLFECNQDTRSFCTFSYRECHYRADIRKKCYRCKECGKSLSTSSGLKI
HQRIHTGERPYKCGDCDKSFTQKSNLRMHQKIHTGENTYKCSECDKCFTQRCLLRTHQRI
HSGEKPYKCSECGKAFAGGSYLRSHQRIHSEKKPYKCSDCDKSFHRKDHLRIHQRIHTGE
KPYKCSECDKCFTQKGSVRIHQRIHTGEKPYKCSKCDKSFTKKDCLKIHQIIHTGEEPYK
CSECDTSFNRKDHLRTHQRFHTGERIYKCSECDESFTQKINLRIHQKIHTGDNSYKCSGC
DKSFNRRNHLRTHERIHAGEKPYNCREFENSFIQTGSLRIHQRLHSRKKLYKCRECDKSF
TSSSYVRIHQRIHSGEKPYKCSECGKCFTSGSYLRMHQRIHTGDKPYKCSDCDKCFTQKC
SLRIHQRSHTGEKPYKCGNCDRSFTSGSYLRIHQRIHRGEKPHKCSECDKSFTQKGYLRI
HQRIHKGEKSHKGS
NT seq 2385 nt   +upstreamnt  +downstreamnt
atggtgaagagagaggagactatagtaaagaatccagaaacttggaaaagagcaataaga
agaatgacagcttctttggtaaatgctccccaggaactgttaacattcaaggaagtggct
gttgacttctcacaggaggaatgggaatgtcttgactgtgctcagagggcattgtacatg
gatgtgatgctagagaattacaacaatctactctttgtggagaataatcatcatgtgtgt
gtcaaacatgatgaagtcttgggccaaggctcaaagtatagtgcccctgagcatgtgaat
attcaagagaagtctaataaatggaaggaatgtggcaaaatgattcatgaatcctccaaa
agtacaccttatcaaaccaacaacagagatgcctccattgaatcatcaaacagacacaaa
actgagaatgccagggaaccatgcaagtataaggactgtgtgaatggcttaaatttgtat
cccatcacttgtcacaatcaaacagtgtacctagaaataaaagaacataccaaaacactg
tatgatgaagcttttctctctaaatataaactcatgctaaaaggaaacaatagtggaatg
aaatcacacaagtgcaggaagtctggaaaattcttcacgatgacctcaagcctgagtggg
catccgagagatcatgctagagagaagccctatcaatgtacaaagtgtagtaaatccttt
ctgcatttgtcacacctccaactgcattacaaaatccattttggaggatatccctacaaa
tgtacagaatgcggtaagtgcttttatcatgcatcaggctttgaaagacattgcagaatc
catgctacaaagaatacttacaaatgtagtttttgtagcaaatcctttatctgctgctca
ggtcttagaaaacatcagaaaattcatgaagaaaacaggctttttgaatgtaaccaagat
actagatcattctgtacattttcctaccgtgaatgccattaccgtgctgatataagaaag
aaatgttacagatgtaaagaatgtggcaaatccctttctacatcctcaggacttaaaata
catcagagaattcatactggagagagaccttacaaatgtggtgactgtgacaaatctttt
acccagaagagcaatcttagaatgcatcagaaaattcatacaggagagaatacttacaaa
tgcagtgaatgtgacaaatgctttacccagagatgccttcttagaactcatcagagaatt
cattcaggagaaaaaccttacaaatgtagtgaatgtggcaaggcctttgctggtggctca
tatcttagaagtcatcagagaattcattcagaaaagaagccttacaaatgcagtgactgt
gacaaatccttccaccggaaagaccaccttagaattcatcagagaattcatacaggagag
aaaccttataaatgtagtgaatgtgacaaatgctttacccagaaaggcagtgttagaatt
catcagagaattcatacaggagagaaaccttacaaatgtagtaaatgtgataaatctttt
accaagaaagactgtcttaaaattcatcagataattcatacaggcgaagaaccttacaaa
tgtagtgaatgtgacacatcctttaaccggaaagaccatcttagaactcatcagagattt
cacacaggagagagaatttacaaatgtagtgaatgtgatgaatcctttacccagaaaatt
aatctaagaattcatcagaaaattcatacaggagacaactcttacaaatgtagtggatgt
gacaaatcctttaaccggagaaaccatcttagaactcatgagagaattcatgccggagaa
aagccttacaattgtagggaatttgaaaattcctttatccagactggctctcttagaatt
catcagagacttcattcaagaaagaaactttacaaatgcagggaatgtgacaaatccttt
actagcagctcatatgtcagaatacatcagagaattcattcaggagagaaaccttacaaa
tgtagtgagtgtggcaaatgcttcactagtggctcatatcttagaatgcaccaaagaatt
catacaggagacaaaccttacaaatgtagtgactgtgataaatgctttactcagaaatgc
agtcttagaattcaccagagaagtcatacaggagagaaaccttacaaatgtggtaattgc
gacagatcttttacaagtggctcatatcttagaattcatcagagaattcatagaggtgag
aaacctcataaatgtagtgaatgtgacaaatcctttacccagaaaggctatcttagaatt
catcagagaattcataaaggagaaaaatctcacaaaggtagttag

DBGET integrated database retrieval system