KEGG   Mus musculus (mouse): 240064
Entry
240064            CDS       T01002                                 

Symbol
Zfp799, 6030490I01Rik
Name
(RefSeq) zinc finger protein 799
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    240064 (Zfp799)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    240064 (Zfp799)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    240064 (Zfp799)
SSDB
Motif
Pfam: KRAB RyR MMS19_N
Other DBs
NCBI-GeneID: 240064
NCBI-ProteinID: NP_001280158
MGI: 2443934
Ensembl: ENSMUSG00000095253
Vega: OTTMUSG00000056165
UniProt: Q6P5N6
Position
17; 17 B1
AA seq 64 aa
MESVTLEDVAVNFTLEEWTMLNASQKELYKDVMQDTLRNLSYIGNKWEHQNIENEYETLW
RKLR
NT seq 195 nt   +upstreamnt  +downstreamnt
atggagtcagtgaccttggaggatgtggctgtgaacttcaccttggaagagtggactatg
ctgaatgcatcccaaaaggagctctacaaagatgtgatgcaggacaccttgaggaacctg
tcctatataggaaacaaatgggaacaccaaaatattgaaaatgagtatgaaactctctgg
agaaaactaaggtaa

DBGET integrated database retrieval system