KEGG   Mus musculus (mouse): 240595Help
Entry
240595            CDS       T01002                                 

Gene name
Kcnv2, KV11.1
Definition
(RefSeq) potassium channel, subfamily V, member 2
  KO
K04935  potassium channel subfamily V member 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    240595 (Kcnv2)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   240595 (Kcnv2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans BTB_2 Ion_trans_2 PKD_channel
Motif
Other DBs
NCBI-GeneID: 240595
NCBI-ProteinID: NP_899002
MGI: 2670981
Ensembl: ENSMUSG00000047298
Vega: OTTMUSG00000020413
UniProt: Q8CFS6
Position
19; 19 C1
AA seq 562 aa AA seqDB search
MLKQSNERRWSLSYKPWSTPETEDVPNTGSNQHRRSICSLGARTGSQASIAPQWTEGNYN
YYIEEDEDCGEEGEDWKDDLAEENQKAECLTSLLDGHNDTPAQMSTLKVNVGGHSYLLEC
CELANYPKTRLGRLATSTTRRGQLGLCDDYEAQTDEYFFDRDPAVFQLIYNFYTSGVLLV
RDELCPRSFLEELGYWGVRLKYTPRCCRICFEERRDELSEQLKIQRELRAQAQAEEAEEL
FRDMRFYGPQRQRLWNLMEKPFSSVAAKAMGVATNLFVLISVVALALNTVEEMQHQAEQG
TGGGDPRPILEHVEMLCVAFFTLEFLLRLASTPNLQRFARSALNLVDLVAILPFYLQLLL
ECFTSEDQRHNKDSPREHDLETVGRVGKVGQVLRIMRLMRIFRILKLARHSTGLRAFGFT
LRQCYQQVGCLMLFITMGIFSFSAAVYSVEHDVPGTNFTSILHAWWWAAVSISTVGYGDM
YPETHLGRLFAFLCIAFGIILNGMPISILYNKFSDYYSKLKAYEYTAIRRERGKVNFMQR
ATKKMAECLSESHAQSTTRQEN
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaacagagcaacgagaggagatggtccttgagctacaagccctggagtacccca
gagactgaggatgtgcccaacactgggagcaaccaacaccgcaggagcatctgctccttg
ggagcccgcactggctctcaggccagcatcgcaccacaatggaccgagggcaactacaat
tactacattgaggaagatgaggactgcggggaggagggggaggactggaaggatgatctt
gccgaagagaatcagaaggcggagtgcctcacaagcctcctggatggccacaacgatact
ccagcccaaatgtccacgctgaaagtgaacgtaggcggccacagctatctgctggaatgc
tgtgagctggccaactaccccaaaacgcgcctgggtcgcctggccacctccaccactcgc
agaggccagctgggcctgtgtgatgactacgaggcacagacagacgagtacttctttgac
cgtgacccagcggtcttccagctcatctacaacttctacacatccggggtgttgctggtg
cgagacgagctgtgtccacgcagctttctcgaggagctgggctactggggagtgaggctc
aaatacacgccacgctgctgtcgcatctgcttcgaggagcggagggatgaactgagcgag
caactgaagatccaaagggagctgcgcgcgcaggcgcaggccgaggaggccgaggagctc
tttcgggacatgcgcttctatggaccacaacgtcaacgcctctggaacctcatggagaag
cccttttcctctgtggccgccaaggccatgggggtggccaccaacctcttcgtgctcatc
tccgtggtggccctggcgctcaacacggtggaggagatgcagcaccaggcggagcagggc
acaggtggtggggaccccaggcccatcttggagcacgtggagatgctgtgcgtggctttc
ttcactctggagttcctgctgcgcctcgcctccacccctaacctgcagcgctttgcacgc
agcgccctcaacctagtggacctggtggccattctgcctttctacctgcagctgctgctc
gagtgcttcacgagcgaggaccagaggcacaacaaggactccccacgagaacacgacctg
gagaccgtgggccgagtgggcaaggtaggccaggtgctgcgcatcatgcgcctcatgcgc
atcttccgaatcctcaagctggctcgccactccacagggctgcgggcctttggcttcacc
ctgcgccagtgctaccagcaggtgggctgcctgatgctcttcatcactatgggcatcttc
tccttctctgcagctgtctactcggtggagcacgacgtgcctggtaccaacttcaccagc
atcctccatgcctggtggtgggccgcggtaagcatctccaccgtgggctatggagacatg
tacccggagacccacctgggcaggctttttgccttcctctgcatcgcttttggcattatt
ctcaatgggatgcccatttccatcctctacaacaagttctccgattactacagcaagctc
aaagcttacgagtacaccgccatccggagggaacgaggaaaggtcaactttatgcagaga
gccacaaagaaaatggctgaatgtttatctgaaagtcatgcacagtccaccacaaggcaa
gagaattaa

DBGET integrated database retrieval system