KEGG   Mus musculus (house mouse): 242466
Entry
242466            CDS       T01002                                 
Symbol
Zfp462, 6030417H05, 9430078C22Rik, Gt4-2, Zfpip, Znf462
Name
(RefSeq) zinc finger protein 462
  KO
K24853  zinc finger protein 462
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    242466 (Zfp462)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    242466 (Zfp462)
SSDB
Motif
Pfam: zf-H2C2_5 zf-H2C2_2 zf-C2HE zf_C2H2_ZHX zf-C2H2_4 zf-C2H2
Other DBs
NCBI-GeneID: 242466
NCBI-ProteinID: NP_766455
MGI: 107690
Ensembl: ENSMUSG00000060206
UniProt: B1AWL2 Q69ZA0 Q8CD61
Position
4:54942038..55083563
AA seq 2495 aa
MEVLQCDGCDFRAPSYEDLKAHIQDVHTAFLQPTDVAEDNDDEPLSGSMNASNQTEVEFS
SIKDEFVIAEDLPGQSATALGSGGYYGHSPGYYGQHITPNPKPTNKFFQCKFCVRYFRSK
NLLIEHTRKVHGAQAEESPTGPPVPGSLNYNIMMHEGFGKVFSCQFCTYKSPRRARIIKH
QKMYHKNSLKESTAPPPAPAPLPDPLVPPVSLQDPCKELPAEVVERSILESMVKPLTKSR
GNFCCEWCSYQTPRRERWCDHMMKKHRSMVKILSSIRQQEGPNVSEAQNDNEPSPTSNST
YLSMNAASREMPNANVSNFRGSMGNSIMRPNSSSTSKFSSSMSYPQMKPKSPHNSGLVNL
TERSRYGMSDMTNSSADLDTNSMLNDSSSDEDLNEVDSENGLSVLDHQASGLSAEQLMGS
DGNKLLETKGIPFRRFMNRFQCPFCPFLTMHRRSISRHIENIHLSGKTAVYKCDECPFTC
KSSLKLGAHKQCHTGTSDWDTVNSQSESLSSSLNEGMVSYESSSINGRKSGVMLDPLQQQ
QPPQPPPPLPPPPPPPSQPLPQPPPPPLQSPHQVPPPTQQPQPPTQAPPLHPYKCTMCSY
STMTLKGLRVHQQHKHSFCDNLPKFEGQPSSLPLENETDSHPSSSNTVKKSQTSILGLSS
KNNFVAKANRKLASDFPLDLSPVKKRTRIDEIASNLQSKINQTKLQEDAIINVEDDEEEE
DDNEVEIEVELDREEEATDPIMEVPTAFSAQQIWARDASEAQKEPNYRSITHDYTATNGA
EIELTLSEDEEDYYGSSASMKDQVSNAALLNTQPAIYGTEPSNENTDFGDSGRLYYCKHC
DFNNKSARSVSTHYQRMHPYIKFSFRYILDPNDHSAVYRCLECYIDYTNFEDLQQHYGEH
HPEAMNVLNFDHSDLIYRCRFCSYTSPNVRSLMPHYQRMHPTVKINNAMIFSSYVVEQQE
GLNAESQTLREILNSAPKSMATSTPVARGGGLPATFNKNTPPKTFTPECESQKDPSVNTV
VVYDCDVCSFASPNMHSVLVHYQKKHPEEKASYFRIQKTMRMVSVDRGSALSQLSFEVGA
PMSPKMSNMGSPPPPQPPPPDLSIELYYCKHCSYSNRSVVGVLVHYQKRHPEIKVTAKYI
RQAPPTAAMMRGAEGLQDSPRPPAPLQLNSSERDCPPVETEMFFCQHCDYGNRTVKGVLI
HYQKKHRDFKANADVIRQHTATIRSLCDRNQKPASCVLLPASGMERDKTKLRALKCRQCS
YTSPYFYALRKHIKKDHPALKATVTSIMRWAFLDGLIEAGYHCEWCIYSHMEPSGLLLHY
QRRHPEHYVDYTYMATKLWAGPDPSSPTLTMSAEAKTYRCRDCVFEAVSIWDITNHYQAF
HPWAMNGDESVLLDIIKEKDGVDKALLAPEELIGPVNCENSIPNPLPEQEAECPEDARLS
PEKSIHLASANPAISSTPYQCTVCQSEYNNLHGLLTHYGKKHPGMKVKAADFAQDIDINP
GAVYKCRHCPYINTRIHGVLTHYQKRHPAIKVTAEDFVHDVEQSADISQNDVEETSRIFK
QGYGAYRCKLCPYTHGTLEKLKIHYEKYHNQPEFDVFSPPPPKLPVSLEPEITTEVSPSQ
VSVTEEEVGEDPMSTAHFSTSHLVSHTVFRCQLCKYFCSTRKGIARHYRIKHNNVRAQPE
GKNNLFKCALCAYTNPIRKGLAAHYQKRHDIDAYYTHCLAASRTISDKPNKVIIPSPPKD
DSPQLSEELRRAVEKKKCSLCSFQSFSKKGIVSHYMKRHPGVFPKKQHASKLGGYFTAVY
ADEHEKPPLMEEEERSSFERAEVEGEAQDIEWLPFRCIKCFKLSFSTAELLCMHYTDHHS
RDLKRDFVILGSGPRFQNSTFQCKHCDSKLQSIAELTSHLNIHNEEFQKRAKRQERRKQL
LSKQKYADGAFADFKQERPFGHLEEVPKIKERKVVGYKCKFCVEVHPTLRAICNHLRKHV
QYGSVPAVSAAVKGLRSHERSHLALAMFTREDKYSCQYCSFVSAFRHNLDRHMQTHHGHH
KPFRCKLCSFKSSYNSRLKTHILKAHAGEHAYKCSWCSFSTMTISQLKEHSLKVHGKALT
LPRPRIVSLLSSHAHPSSQKATPAEEVEDSNDSSYSEPPDVQQQLNHYQSAALARNKSRV
SPVPPSGTAAGTEQKAEAVLHCEFCEFSSGYIQSIRRHYRDKHGGKKLFKCKDCSFYTGF
KSAFTMHVEAGHSAVPEEGPKDLRCPLCLYHTKYKRNMIDHIVLHREERVVPIEVCRSKL
SKYLQGVVFRCDKCTFTCSSDESLQQHIEKHNELKPYKCQLCYYETKHTEELDTHLRDEH
KVSRNFELVGRVNLDQLEQMKEKIESSSSEDEDKDDEMSSKAEDRELMRFADRGPGVNTE
KRFPCEFCGRAFSQGSEWERHVLRHGMSLHDTNQVSRNEIHTKEMVEESMQLPSIEAKED
DEPIGIDFPLKSETVTICVVAADKSLLEDAEAKNE
NT seq 7488 nt   +upstreamnt  +downstreamnt
atggaggtgcttcagtgcgatggctgtgacttccgagccccatcttacgaagatctcaag
gcacacatccaggatgtccacacggcattcttacagccaactgatgttgccgaggacaat
gatgacgagccactatctgggtccatgaatgctagtaatcagacagaggtggagttctct
tctataaaggatgagtttgtgattgcagaggatttaccaggtcaaagtgcaactgcgttg
gggagcggaggttactatggccacagtccaggatattacggtcagcatattacccctaat
cccaaaccaaccaacaaattttttcagtgcaagttctgcgtacgctacttcaggtcaaaa
aatctcctcatagaacatactaggaaggtccatggagctcaagctgaagagagtcccaca
ggacctcctgtcccaggatccttaaattataatatcatgatgcacgaaggatttggaaag
gtcttttcttgccagttttgcacatacaaatcacctcggagggcaaggataattaagcat
cagaagatgtaccacaaaaacagtctgaaggagtccacagcgccaccacctgcccctgct
ccactgccagaccctctggttccacctgtgtcactgcaggacccctgcaaggaactgccg
gcagaggttgttgagcgcagcatcttagaatctatggtcaagcctttgaccaagtctcgg
ggcaacttttgttgtgagtggtgtagctaccagaccccccgcagagaacgctggtgcgat
cacatgatgaagaaacaccgcagtatggtcaagatcctttctagcatccggcagcaagaa
gggcctaatgtctctgaagcgcagaatgataatgaacccagccccacctccaactccacc
tacctgtccatgaatgctgcgagccgggagatgcccaacgctaacgtctccaatttcagg
ggctccatgggcaactccatcatgagacctaattcttcttcaacttccaagttttcttct
tctatgtcttaccctcagatgaagccgaagtcacctcataattctggccttgtgaacttg
acggagaggtcccgttacggaatgtctgacatgacgaattcatctgctgacctggacact
aacagcatgctaaatgactctagctctgatgaggacttaaatgaggtagacagtgagaat
ggtttaagtgttctggatcaccaggcgtcaggactgtctgcagagcagctcatgggctct
gatggcaacaagctgttagagaccaaggggattccatttcgaaggttcatgaatagattc
cagtgtcccttttgtcctttcctcaccatgcaccgccgtagcatttcccgccacatagaa
aatatccacttatctggaaagaccgctgtctacaaatgtgacgagtgtccgtttacttgt
aagagctcattaaaactcggggctcataaacagtgtcacacgggtacgtcggattgggat
actgtgaattctcaaagcgaaagcctgtcttcctcgttgaatgaaggaatggtatcttac
gagagctccagcatcaatggtagaaagtcgggagtcatgttggaccccttacagcagcag
cagccaccacagccacctccgccactaccaccaccaccaccaccaccatcacagccactg
ccgcagcctccacctccaccgctgcagtcaccacaccaggtgccaccaccaacccagcag
ccacagccacccacacaggccccacctttgcacccttacaagtgcaccatgtgtagttat
tccaccatgactctgaaagggctaagagtccatcagcagcacaaacattcattctgcgac
aacttgccaaaattcgaggggcagccctcgagcctaccactggaaaatgagacggatagc
cacccctcttccagcaacactgtgaagaaaagtcagacctcaattcttggattgtcctcc
aagaataactttgtagctaaggccaataggaagcttgctagtgactttcctcttgactta
tcacctgtgaagaagagaacaaggattgacgagatagccagcaatttgcagagcaaaatc
aaccagaccaaactgcaggaagacgcgatcatcaacgtcgaggacgatgaggaggaagag
gatgacaacgaagtcgagatcgaggttgaactggacagggaggaggaggcaacggacccc
atcatggaggtgcccactgccttttcagcccaacagatctgggccagagacgctagtgag
gcccagaaggagcccaactacagaagtatcactcatgattacactgccaccaatggggcg
gagatcgagctcacgctttctgaagacgaagaggattactacggctcttcagcaagcatg
aaagatcaagtgtccaatgcggctctgctgaacacccagcccgctatctatgggacggaa
cccagtaatgaaaataccgattttggggactctggaaggctttactattgtaaacactgt
gactttaataataaatctgcccggagtgttagcacccactaccagcgaatgcacccatac
attaagttcagctttaggtatatcttggaccccaatgatcacagcgcagtgtacaggtgc
ctggaatgctatattgactacaccaactttgaagacctccaacagcattatggtgaacac
cacccagaggccatgaatgtactcaactttgaccattcggacctgatctaccgatgtcgg
ttttgttcttacactagcccgaatgtcagaagcctgatgccgcattaccaaagaatgcat
cccacggtgaaaatcaacaatgctatgatcttttcaagctacgttgtagagcagcaggaa
gggctgaatgctgagtcccagaccctgcgggagattttgaattcagctcccaagagcatg
gcgacgtccacgcctgtggctcgcggtggtggcttgccagctacgtttaacaaaaacact
cctcccaagacctttactccagaatgtgaaagccagaaggacccttcagtgaacaccgtt
gtcgtttacgattgtgacgtttgctcgtttgcgagccccaacatgcactctgtcttggtt
cactatcagaagaaacaccctgaagaaaaggcctcgtactttaggatccagaaaaccatg
cgcatggtgtctgtggacagaggctctgccctttcccaattatcatttgaggtgggtgct
ccaatgtctcccaaaatgtccaacatgggttccccaccccccccacagcccccgccacca
gacctcagtattgagctttactactgcaaacactgctcctacagcaatcggtcagttgtg
ggggtgcttgttcactaccagaaaagacacccagaaataaaggtcactgccaaatatatc
agacaggctcctcccacagctgcaatgatgagaggggctgaagggctccaagattcccct
cggcctcctgctcccttgcagctgaacagttctgagagagattgccctcctgtggagact
gagatgtttttttgccagcactgtgattatgggaaccggacggtcaaaggcgtcctcatt
cattatcagaagaagcaccgggacttcaaggccaatgccgatgtgatcaggcagcacaca
gccaccatccgaagcctctgtgaccggaaccagaagcctgccagctgtgtgcttctccct
gcttccggtatggagcgggacaaaacgaaacttcgagcgctcaaatgtaggcagtgctcg
tatacctccccctatttctatgcactgaggaagcatatcaagaaagaccaccctgccctg
aaggccacagtcacgtccatcatgcggtgggcatttctagatggcttgatagaagctggc
taccactgcgagtggtgtatctactcccacatggagcccagtggtttgctcctgcattat
cagaggagacaccctgagcattatgtagattatacttatatggctaccaaactctgggct
gggccagacccatcctctcccactcttaccatgtcagctgaagccaaaacatacagatgc
agggactgcgtttttgaagccgtctccatctgggacatcacaaaccattaccaagcgttc
cacccctgggccatgaatggtgatgagtctgtgttgctggatatcatcaaggagaaagac
ggtgtagacaaggccctcctggcacctgaagagttgataggccctgtgaattgtgaaaat
agtatacccaacccccttcccgagcaggaagctgagtgcccagaggatgcaagactttcc
ccagagaaaagcattcatctggcttcagctaaccctgctatatcttccaccccataccag
tgtacagtgtgccagtccgagtacaacaacttgcacggcctcctcacccattacgggaag
aagcatcctggtatgaaagtgaaggctgctgattttgcccaggatattgacatcaaccca
ggtgccgtctacaaatgcaggcattgtccgtacatcaacactcgcatccatggcgtcctg
acccactatcagaagcgacacccggccatcaaggtgaccgctgaggactttgtgcatgat
gtggagcagtctgctgacatatcccagaatgacgtggaggagacaagtaggatttttaaa
caagggtatggtgcctaccggtgcaagctgtgtccttacacacacggcactctggagaaa
ctcaaaatccactatgagaagtaccacaaccagcctgagtttgatgtcttttccccgcct
cctccgaagctgccagtgtcccttgaacctgagataaccactgaagtgagcccctcccag
gtctccgtgacggaggaggaggtgggagaggatcctatgtccactgctcacttctctacc
tcgcatctggtctcccacactgtgttccggtgccagctctgcaagtacttctgttccact
aggaagggcattgccaggcactaccggatcaagcacaataatgtccgtgcccagcccgag
ggcaaaaacaatctcttcaagtgtgccctgtgtgcctacaccaaccccatccgcaaggga
ctggcagcccactaccagaagcgccacgacattgatgcatattacacccactgccttgcg
gcctccaggaccatcagtgacaagcccaacaaggtgatcatcccatccccacccaaagat
gactctcctcagctgagcgaggaactccggcgggctgtggagaagaaaaagtgctcctta
tgttccttccagtccttcagcaagaaaggcattgtgtcccattatatgaagcgccacccg
ggggtgttcccaaagaagcagcatgccagcaagttggggggctacttcacagcggtctac
gcagatgaacacgagaaacccccactgatggaagaagaggagagaagcagctttgagagg
gccgaggtggaaggcgaagctcaagacatcgagtggctcccgttccgctgcatcaaatgc
ttcaagctgtccttcagcacggcggagttgctgtgcatgcattacacagaccaccacagc
agggacttaaagagggacttcgtcatcctaggcagcggcccccgcttccagaactccacc
ttccagtgtaagcactgtgatagcaaattgcaaagcatagccgagctgacctcacacttg
aacatccacaatgaggaattccagaagcgtgccaaacgccaggagaggaggaaacagctt
ttgagcaagcagaaatatgcagatggtgcttttgcagatttcaaacaagagaggcctttt
ggtcacttagaagaggtgccaaagatcaaggagaggaaagtggtgggctacaagtgtaaa
ttctgcgtggaagtgcatccaacgcttcgggccatctgtaaccacctccggaaacatgtc
cagtatggtagcgtcccggctgtgtcggctgctgtgaaggggctgcgttctcatgagagg
agccacctggccttggccatgtttaccagagaggacaagtacagctgccagtattgctcc
tttgtttctgcattcagacacaacttggatcgccatatgcagacccatcacggacaccac
aaaccgttccgctgcaaactctgctctttcaagtcctcctacaacagccggttgaagaca
cacatcctcaaagcccatgctggtgaacatgcctacaagtgttcttggtgctcattttcc
accatgacaatcagccagttgaaggaacattccctcaaggtccatggcaaagccctgacc
cttccccggccacggattgtcagtctcctctcctcacatgctcacccctcctcccagaag
gccactccagccgaagaagtggaagactccaatgactcctcttactcggagccccccgat
gttcagcagcagctgaatcactaccagtcagccgccctggcaagaaacaagagccgcgtt
agccctgtgcctccttctgggactgctgctggcacggaacagaaggcagaagccgttctt
cactgcgaattctgtgaattctcctctggctacatccagagcatcaggcgccattaccgg
gacaagcacggtgggaagaagcttttcaaatgcaaagactgctccttttacaccggcttt
aaatctgcttttactatgcacgtggaagctgggcattcggcggtcccggaggaaggcccc
aaagatctccgctgtcctctctgcctctatcacaccaaatacaaacgcaacatgatcgac
cacatagtgctgcaccgagaagagcgagttgtccccattgaagtgtgccgttccaaactg
tcaaaatacttgcagggagtagttttccgctgtgataagtgtaccttcacctgctccagt
gacgagagtctccagcaacacatagaaaagcacaatgaactgaaaccgtacaaatgccag
ctctgctactatgagaccaagcacacggaggaactggacactcaccttcgggatgagcac
aaggtgagccggaactttgagctggttggccgggtgaacttggatcagctggaacagatg
aaggagaagattgagagttccagcagcgaggacgaggacaaggacgacgaaatgagcagc
aaggctgaggacagagagctgatgagatttgcagaccgggggcctggtgtgaacacagag
aagcgatttccatgtgaattctgtggacgggcgttctcacagggctctgagtgggaaaga
cacgtgttgagacacggcatgtcattgcatgataccaaccaagtgagcaggaacgaaatc
catacaaaggagatggtggaggagagtatgcagctgccctccatagaggccaaggaagac
gatgagccaattgggatagactttcccttaaagagcgaaacagtaaccatctgtgtagtg
gctgccgacaaatctctcctggaggatgcagaggccaaaaacgaataa

DBGET integrated database retrieval system