KEGG   Mus musculus (house mouse): 242509
Entry
242509            CDS       T01002                                 
Symbol
Bnc2, 5031434M05Rik, 8430420F16Rik
Name
(RefSeq) basonuclin zinc finger protein 2
  KO
K24146  zinc finger protein basonuclin
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    242509 (Bnc2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    242509 (Bnc2)
SSDB
Motif
Pfam: zf-C2H2 zf-met zf-C2H2_4 zf-C2H2_jaz zf-C2H2_aberr
Other DBs
NCBI-GeneID: 242509
NCBI-ProteinID: NP_766458
MGI: 2443805
Ensembl: ENSMUSG00000028487
UniProt: Q8BMQ3 Q2TBA4
Position
4:complement(84185041..84593236)
AA seq 1032 aa
MARFVPSPPPNCLSYKSEGRLGEQDWQAHFKVPCCGVDPSQLEAIRCTLVNCTCECFQPG
KINLRTCDQCKHGWVAHALDKLSTQHLYHPTQVEIVQSNVVFDISSLMLYGTQAVPVRLK
ILLDRLFSVLKQEEVLHILHGLGWTLRDYVRGYILQDAAGKVLDRWAIMSREEEIITLQQ
FLRFGETKSIVELMAIQEKEGQAVAVPSSKTDSDIRTFIESNNRTRSPSLLAHLENSNPS
SIHHFENIPNSLAFLLPFQYINPVSAPLLGLPPNGLLLEQPGLRLREPSISTQNEYNESS
ESEVSPTPYKSDQTPNRNALTSITNVEPKTEPACVSPIQNSAPVSDLSKTEHPKSSFRIH
RMRRMGSASRKGRVFCNACGKTFYDKGTLKIHYNAVHLKIKHRCTIEGCNMVFSSLRSRN
RHSANPNPRLHMPMLRNNRDKDLIRATSGAATPVIASTKSNLTLTSPGRPPMGFTTPPLD
PVLQNPLPSQLVFSGLKTVQPVPPFYRSLLTPGEMVSPPTSLPTSPIIPTSGTIEQHPPP
PSEPIVPAVMMGTHEPSADLAPKKKPRKSSMPVKIEKEIIDTADEFDDEDDDPNDGGTVV
NDMSHDNHCHSQDEMSPGMSVKDFSKHNRTRCISRTEIRRADSMTSEDQEPERDYENESE
SSEPKLGEESMEGDEHLHSEVSEKVLMNSERPDENHSEPSHQDVIKVKEEFTDPTYDMFY
MSQYGLYNGGGASMAALHESFTSSLNYGSPQKFSPEGDLCSSPDPKICYVCKKSFKSSYS
VKLHYRNVHLKEMHVCTVAGCNAAFPSRRSRDRHSANINLHRKLLTKELDDMSLDSSQPS
LSKDLRDEFLMKIYGAQHPLGLDGREDASSPAGTEDSHLNGYGRGMAEDYMVLDLSTTSS
LQSSSSVHSSRESDAGSDEGILLDDIDGASDSGESTHKAEAPTLPGSLGAEVSGSLMFSS
LSGSNGGIMCNICHKMYSNKGTLRVHYKTVHLREMHKCKVPGCNMMFSSVRSRNRHSQNP
NLHKNIPFTSID
NT seq 3099 nt   +upstreamnt  +downstreamnt
atggcacgttttgtgccctccccgcctccaaattgcctcagttacaaatcagagggcagg
cttggtgagcaagactggcaagcacattttaaggtcccgtgctgtggggttgatccatct
caacttgaggccatccgctgcacattggtaaactgcacgtgtgagtgtttccagcctggg
aagattaacctgcggacgtgtgatcagtgtaaacatggctgggtggcacatgccttggat
aaactcagcacacagcacctgtaccaccccactcaagtggagattgtgcagtccaacgtg
gtgtttgacatcagcagcctgatgctctacgggacgcaggcagtgcctgtgcggctaaag
atactgctagaccggctcttcagtgtcctgaagcaagaggaagtgctgcacatactacat
ggcttgggctggaccctgagggactatgtccgaggatacatccttcaggacgctgctggc
aaggtactggaccgctgggccatcatgtctcgggaagaagaaatcatcacccttcagcag
tttctgcggtttggggaaaccaaatccatcgtggagctgatggcaattcaggagaaagaa
gggcaagccgtggctgtaccatcttcaaagacagactcggatataaggactttcattgag
agcaataatcgcaccaggagtcctagcctccttgctcacttagagaacagcaatccttcc
agcatccatcattttgaaaacataccaaacagccttgcatttctgcttccattccagtat
ataaaccccgtgtctgccccactgttagggttgccgcccaacgggctgcttttggagcag
ccggggctgaggctgagggaaccgagcatttcaactcagaatgagtacaatgagagcagt
gaatctgaagtatcgcctacaccatataagagtgatcagacgcccaatagaaatgccctg
actagcatcactaatgtggaacccaaaaccgagccagcatgtgtctcccccattcagaat
tctgccccagtcagtgacctaagcaaaactgaacacccaaaaagctcattccggattcac
cgtatgagaaggatggggtcagcctccaggaaaggaagggtattctgtaatgcttgtggg
aagacgttctatgacaaagggactctcaaaattcactataatgctgttcacctgaagatt
aaacaccgatgtaccattgaaggttgcaacatggtctttagttcccttcgaagccggaat
cgccacagtgcaaaccccaacccccgccttcatatgcctatgctaaggaataaccgagac
aaagatttaatccgggctacatcaggagctgccactccagtcatagcaagtacaaaatca
aatctcacactcacgagtcctggccggcccccgatgggttttaccacccctccactagac
cccgtcttacagaaccctctcccaagccagctggtattttctgggctaaagactgtacag
ccagttcctcctttttatagaagtttacttactccaggggaaatggtgagtcctccaacc
tccctcccaaccagtcccatcattccgaccagtggcaccatagaacagcaccctcctcca
ccctctgagccaatagtgccggcagtgatgatgggcactcatgagcccagcgctgacctg
gcacctaagaaaaagcctaggaagtcaagcatgcctgtaaaaattgagaaggaaatcatc
gacactgccgacgagtttgacgatgaagacgacgatcctaatgacggcgggaccgtggtc
aatgacatgagccatgacaatcactgtcattcccaagatgagatgagcccaggcatgtcc
gtgaaggacttctctaagcataacaggacccggtgcatttcaagaactgaaataagaagg
gctgacagtatgacgtctgaggaccaggagcccgagcgggactatgagaacgagtccgaa
tcctcagagcctaagctcggtgaggaatccatggagggggatgaacaccttcacagtgag
gtgagcgagaaggtcctgatgaacagcgagaggcccgacgagaaccacagcgagccgtcc
caccaggacgtcatcaaggtaaaggaagaatttacagaccccacttacgacatgttctac
atgagccagtacggactatacaacggtggcggggccagcatggctgccctgcatgaaagt
tttacatcgtctctgaattatggaagccctcaaaagttctcccctgaaggtgacctgtgt
tctagtccagaccccaaaatctgttatgtgtgcaagaagagcttcaaaagctcctacagt
gtgaagcttcactacaggaacgttcacttaaaagagatgcacgtctgcacggtggctggg
tgcaatgccgccttcccctctcgtcgaagcagagacagacacagtgccaatataaacctg
catcgtaaactgttgaccaaagaactggatgacatgagcctggactcatcgcagccctcc
cttagcaaggacctccgggatgaatttttgatgaagatctatggtgcccagcaccctctg
gggctcgatggcagggaagatgcctcctctcccgcagggactgaagactcccacctgaat
gggtacgggagaggcatggcagaggactacatggtccttgacctgagtaccacctccagc
ctccagtccagcagcagtgtccattcctccagagagtccgatgcaggcagcgatgagggg
attcttctcgacgacatcgatggcgcgagtgacagtggggaatccactcacaaggccgag
gcccccaccctccccggcagcctcggggctgaagtttcaggatctcttatgttcagcagt
ttgtctgggagcaatggtgggatcatgtgcaacatttgccacaaaatgtacagcaacaag
gggaccctgcgggtccactacaaaactgtgcatttgcgagagatgcataagtgcaaagtc
cccggctgtaacatgatgttctcctctgtgcgaagccgaaacaggcacagccagaacccc
aatcttcacaaaaacattcccttcacttcaatagattag

DBGET integrated database retrieval system