KEGG   Mus musculus (house mouse): 243931
Entry
243931            CDS       T01002                                 
Symbol
Tshz3, A630038G13Rik, Tsh3, Zfp537, mKIAA1474, teashirt3
Name
(RefSeq) teashirt zinc finger family member 3
  KO
K09236  teashirt
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    243931 (Tshz3)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    243931 (Tshz3)
SSDB
Motif
Pfam: zf-C2H2_4 zf-C2H2 zf-C2H2_2 Zap1_zf1 zf-C2H2_6 zf-met zf-C2H2_3rep Homeobox_KN zf-C2HC_2 DUF1043 zf-C2H2_jaz
Other DBs
NCBI-GeneID: 243931
NCBI-ProteinID: NP_758502
MGI: 2442819
Ensembl: ENSMUSG00000021217
UniProt: Q8CGV9 A0A0R4J017
Position
7:36397543..36472978
AA seq 1081 aa
MPRRKQQAPRRAAAYVSDELKAAALVEDDVEPEEQAADGEPSAKYMCPEKELSKACPSYQ
NSPAAEFSSHEMDSESHISETSDRMADFESSSIKNEEETKEVQVPLEDTIVSDSLEQMKA
VYNNFLSNSYWSNLNLNLHQPSSENNGGSSSSSSSSSSSCGSGSFDWHQSAMAKTLQQVS
QNRMLPEPSLFSTVQLYRQSSKLYGSIFTGASKFRCKDCSAAYDTLVELTVHMNETGHYR
DDNHETDNNNPKRWSKPRKRSLLEMEGKEDAQKVLKCMYCGHSFESLQDLSVHMIKTKHY
QKVPLKEPVTPVAAKIIPAARKKPSLELELPSSPDSTGGTPKATLSDASDALQKNSNPYI
TPNNRYGHQNGASYAWHFEARKSQILKCMECGSSHDTLQELTAHMMVTGHFIKVTNSAMK
KGKPIMETPVTPTITTLLDEKVQSVPLAATTFTSPSNTPASVSPKLAVEIKKEVDKEKAV
PDEKPKEREKPSEEEEKYDISSKYHYLTENDLEESPKGGLDILKSLENTVTSAINKAQNG
TPSWGGYPSIHAAYQLPNMMKLSLGSSGKSTPLKPMFGNSEIVSPTKTQTLVSPPSSQTS
PMPKTNFHAMEELVKKVTEKVAKVEEKMKEPEGKLSPPKRATPSPCSSEQSEPIKMEASS
DGSFKSQENSPSPPRDACKEASPSAEPVENGKELVKPLSGGLSGSTAIITDHPPEQPFVN
PLSALQSVMNIHLGKAAKPSLPALDPMSMLFKMSNSLAEKAAVATPPPLQAKKAEHLDRY
FYHVNNDQPIDLTKGKSDKGCSLGSGLLSPTSTSPATSSSTVTTAKTSAVVSFMSNSPLR
ENALSDISDMLKNLTESHTSKSSTPSSISEKSDIDGATLEEAEESTPAQKRKGRQSNWNP
QHLLILQAQFAASLRQTSEGKYIMSDLSPQERMHISRFTGLSMTTISHWLANVKYQLRRT
GGTKFLKNLDTGHPVFFCNDCASQIRTPSTYISHLESHLGFRLRDLSKLSTEQINNQIAQ
TKSPSEKLVTSSPEEDLGTTYQCKLCNRTFASKHAVKLHLSKTHGKSPEDHLLFVSELEK
Q
NT seq 3246 nt   +upstreamnt  +downstreamnt
atgccgaggaggaagcagcaggcgccccggcgcgcagcagcctatgtttccgatgagtta
aaggcagctgccttggtagaagatgacgtagagccggaggaacaagcggcagatggagag
ccctcagccaagtacatgtgtccagagaaggaactcagcaaggcctgccctagctaccag
aactcaccggccgctgagttctccagccatgaaatggacagcgagtctcacatcagtgag
acgagtgaccggatggctgactttgaaagcagttccatcaagaatgaggaggagaccaag
gaggtccaggtgcccctggaggacaccatcgtgtctgatagcctggagcagatgaaggcc
gtgtacaacaacttcctgtccaattcctattggtccaacctcaacctgaacctgcaccag
ccctcctccgagaacaatggtggcagcagtagcagcagcagcagtagcagcagcagctgt
ggcagcgggagctttgactggcaccagagtgccatggcgaagaccctgcagcaggtgtcc
cagaaccgaatgctgccggagcccagcctgttcagcaccgtgcagctgtaccgccagagc
agcaagctgtacggctccattttcaccggggccagcaagttccgttgcaaagactgtagc
gccgcctacgacaccctggtagagctgaccgtgcacatgaatgagacaggtcactatcgc
gatgacaaccacgagaccgacaacaacaaccccaagcgctggtccaagcctcgcaaacgg
tctttgttggagatggaggggaaggaggatgctcagaaggtgctcaagtgtatgtactgt
ggccactcctttgagtccctccaagacctgagcgtccatatgatcaaaactaaacactac
caaaaagtgcctctcaaggaacctgtcacacccgttgcagccaaaatcatccctgctgct
cggaagaaaccttctctggagctggagctgcctagctcccctgattccacaggtggaacc
cccaaagccaccctgtctgatgccagcgacgccctgcagaagaactccaacccttacatc
acgccaaataatcggtacggccaccagaacggggccagctatgcatggcacttcgaggcc
cgaaagtctcagatcctcaaatgcatggagtgtggaagctcccatgacacgctccaggag
ctcacagctcacatgatggtcactggccactttatcaaggtcacaaactcggccatgaag
aaggggaagcccatcatggagacaccggtcacgcccaccatcaccaccttgctggacgag
aaggtgcagtctgtgccactggcagccaccacattcacgtctccctccaatacgcccgcg
agtgtctccccgaagctggcggtggagatcaaaaaggaagtggacaaggagaaagcagtc
ccggatgagaaacccaaggagagagagaagcccagtgaagaggaggagaagtatgatatt
tcttccaagtaccactatttgactgaaaacgacctagaagagagccctaaaggtggacta
gatatcctcaaatcccttgagaacacagtaacgtctgccatcaacaaggctcagaatggc
actcccagctggggcggctatcccagcatccacgctgcctaccagctccccaacatgatg
aagttgtccctgggttcctcggggaagagcacgcccctgaaacccatgtttggcaacagc
gaaatcgtgtctcccacaaaaacccagaccctggtctctccacccagcagccagacctct
cccatgcccaagacaaactttcacgccatggaggaactggtgaaaaaagtcacggagaaa
gttgccaaagttgaggagaaaatgaaagagccagaaggcaagctctcgccacccaagcgg
gccacgccgtccccgtgcagcagcgagcagagcgaacccatcaagatggaggcctccagc
gacggcagcttcaaaagtcaggagaatagccccagcccaccaagagatgcgtgcaaggag
gcgagcccctccgcagagcccgtagagaatggcaaggagctggtgaagcccctgagcgga
ggtctcagcggcagcacagccattatcacggaccacccaccagaacagccttttgtgaac
cccctgagtgccctgcagtcggtcatgaacatccacctgggcaaggccgccaagccctcg
ctgcctgcgctggaccccatgagcatgcttttcaagatgagcaacagtctggccgagaag
gcagctgtggccaccccaccaccccttcaggccaagaaggcggagcatctggaccgctat
ttctaccacgtcaacaatgaccagcccatagacttgacaaaagggaagagcgacaaaggt
tgctctttaggttcagggcttttgtcccccacgtccacatccccggcaacttcctcatcc
acggtgacaacggcaaagacatctgccgtcgtatcattcatgtcaaactcgccgctgcgt
gagaatgccttgtcagatatatccgatatgttgaagaacttgacagagagccacacgtca
aaatcctccactccttccagcatctctgagaagtctgacattgacggggccaccctggaa
gaggccgaggagtcgactccggcgcagaagaggaaaggccgccagtcaaactggaatcct
cagcacctgctaatcctgcaggcgcagtttgcagctagcctgcggcagacttcagaaggg
aagtacatcatgtccgatctgagcccccaggagcgcatgcacatctccaggttcaccggt
ctctccatgaccaccatcagccattggctggccaatgtgaagtaccaacttcgaaggaca
ggtggaacaaagttcctcaaaaacttggacactggacacccagtgttcttttgtaacgac
tgtgcgtcacaaatcaggactccttccacgtacatcagccacctagagtcacatctgggc
ttccggctacgggacttatcaaaattgtccaccgaacagattaacaatcaaatagcacaa
accaagtcgccgtctgaaaaactggtgacatcctccccggaggaggatctggggaccacc
taccagtgcaaactttgtaatcggacctttgcgagcaagcatgctgttaaacttcacctt
agcaaaacccacgggaaatcaccggaagaccacctcctgttcgtttctgaattggagaag
cagtag

DBGET integrated database retrieval system