KEGG   Mus musculus (house mouse): 244216
Entry
244216            CDS       T01002                                 
Symbol
Zfp771, G630024C07Rik, Znf771
Name
(RefSeq) zinc finger protein 771
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 Zn-ribbon_8 zf-C2H2_jaz zf_UBZ zf-C2H2_11 Zn_ribbon_SprT zf-C2H2_6 HVO_2753_ZBP zf-Di19 zf-H2C2_5 zf-met zf-C2HC_2
Other DBs
NCBI-GeneID: 244216
NCBI-ProteinID: NP_796336
MGI: 2442050
Ensembl: ENSMUSG00000054716
UniProt: Q8BJ90
Position
7:126842168..126854044
AA seq 317 aa
MPGEQQAEEEEEEEMQEEMVLLVKGEEEEGEEKYEVVKLKIPVDNKEVASQMPAPSADPA
RPHACPDCGRAFARRSTLAKHARTHTGERPFACTECGRCFSQKSALTKHGRTHTGERPYQ
CPECDKRFSAASNLRQHRRRHTGEKPYACAHCGRRFAQSSNYAQHLRVHTGEKPYACPDC
GRAFGGSSCLARHRRTHTGERPYACADCGTRFAQSSALAKHRRVHTGEKPHRCAVCGRRF
GHRSNLAEHARTHTGERPYPCTECGRRFRLSSHFIRHRRAHMRRRLYICAGCGRDFKLPA
SATAATPTERCPECEGS
NT seq 954 nt   +upstreamnt  +downstreamnt
atgcctggcgaacagcaggcagaggaggaggaggaggaagagatgcaggaggagatggtg
ctgctggtgaagggtgaggaggaggagggtgaggagaagtatgaggtggtgaaactcaag
atccctgtggacaacaaggaggttgccagccagatgccagcgccatcggccgacccggcg
cgcccccacgcgtgcccggactgcggccgcgcctttgcgcgccgctccacactagccaaa
catgcgcgcacgcacacgggcgagcgtccctttgcgtgcacggaatgcggccggtgcttc
tcgcagaagtcggcgctgaccaagcacggccgcacgcatacgggcgagcgaccctaccaa
tgcccggaatgcgacaagcgcttctccgccgcctcgaacctgcggcagcaccggcggcgt
cacaccggagagaagccgtacgcatgcgcacactgtgggcggcgctttgcgcagagctcc
aattacgcgcagcatctgcgcgtgcacacgggcgagaagccttacgcgtgcccggactgc
ggacgagccttcggcggaagttcgtgcctggcgcgccaccgacgcacgcacacgggcgag
cgcccgtacgcatgcgccgactgcggcacgcgcttcgctcagagctcggcgctggccaag
caccggcgcgtgcacacgggcgagaagccgcaccgctgcgccgtgtgcggccggcgcttc
ggccaccgttccaacctggcggagcatgcgcgcacgcatacgggcgagcggccctacccg
tgcacggagtgcggccggcgcttccgcctcagctcacacttcatccgccaccgtcgcgcg
cacatgcggcgccgcctctacatctgcgcgggctgcggccgagacttcaagctacccgcc
agtgccacagccgccacgcccaccgagcgctgcccggagtgcgagggcagctga

DBGET integrated database retrieval system