KEGG   Mus musculus (mouse): 245240
Entry
245240            CDS       T01002                                 

Symbol
9930111J21Rik2, 9930111J21Rik, Irgb5
Name
(RefSeq) RIKEN cDNA 9930111J21 gene 2
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: IIGP MMR_HSR1 RsgA_GTPase Dynamin_N ABC_tran AAA_16 FeoB_N DLIC AAA_29 AIG1 Roc AAA_22 RNA_helicase Zeta_toxin AAA_23
Other DBs
NCBI-GeneID: 245240
NCBI-ProteinID: NP_775610
MGI: 3711310
Ensembl: ENSMUSG00000069892
Vega: OTTMUSG00000005540
UniProt: Q8CB10
Position
11; 11 B1.2
AA seq 467 aa
MGQTSSSTPPPKEDPDLTSSFGTNLQNFKMKTKILSQELIAFIESSLEDGNLQETVSAIS
SALGGIEKAPLNIAVMGETGAGKSSLINALQGVGDDEEGAAASTGVVHTTTERTPYTYTK
FPSVTLWDLPGIGSTAFQPHDYLKKIEFEEYDFFIIVSSGRFKHNDAELAKAIVQMNRSF
YFVRTHTDLDLMVVKRSNPRRFNRENTLKQIRHTISSMLKEVTHQEPPVFLVSNFDVSDF
DFPKLESTLLSQLPAYKHHMFMLTLPIVTDSTIDRKRDMLKQKVWKESTMPRAWATIPSL
GLTQKDMEMLQQTLNDYRSSFGLDEASLENIAEDLNVTLEELKANIKSPHLLSDEPDTSL
TEKLLKYIGNPYFSKVFHLQNYFIDTVASDVKIILSKEELFTEQVSSFNSKASLYREESV
GKVFPVGPGSTFLFHFIEMFQSDSDELCHVHVLLLLTSGGLSSETVT
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgggtcagacttcctcttctacaccccctccaaaagaggatcctgatttgacctccagc
tttggcacaaatcttcagaatttcaagatgaaaaccaaaatcctgtctcaggaattaatt
gccttcattgaatcatccctagaggatggaaaccttcaggaaacagtttctgcaatcagc
agtgctctgggtggcatagagaaagccccactgaacattgcagtgatgggggagactggg
gctggaaagtccagtctcatcaatgctctccagggagtgggggatgatgaagaaggtgca
gctgcttccacaggggtggtacatacaaccactgagagaacaccatacacttacacaaag
tttcccagtgtgacactgtgggacctgcctggcattggatctactgccttccaaccacat
gattatctgaagaaaatcgagtttgaggagtatgacttcttcattattgtctcttccgga
cgctttaaacataatgacgcagaacttgccaaagccattgtgcaaatgaataggagtttc
tattttgttcgaacccacacagatcttgatttaatggttgtaaaacggagtaatcctagg
agattcaacagagagaacacattaaagcagattcgacataccatttcaagtatgcttaag
gaagttacccaccaggagcctccagtcttcttagtctctaactttgatgtgtctgacttt
gacttcccaaagctggaatccacccttctgagccagctcccagcctacaaacaccacatg
ttcatgctcactttgcctattgttacagattccaccatagaccggaagagggatatgctg
aaacaaaaggtctggaaggaatccacaatgccaagagcatgggctaccataccatccctg
ggactgacccaaaaggacatggagatgttgcaacagactttgaatgactatagatcttcc
tttggcctggatgaggcatcactggaaaacatcgctgaggatttgaacgtgacactggag
gagctcaaggcaaacattaagtctccacatttgctctcagatgagccagatacatcctta
acggagaaactattgaagtacattggaaatccttacttttcaaaggttttccatttgcaa
aattatttcattgacacggttgcgagcgatgttaaaattatcctcagtaaagaagagctt
ttcacagagcaggtgagctcattcaactctaaggcctctctatatcgggaggagtccgtg
ggcaaagtgtttccagttggtccaggaagcacctttctatttcatttcattgaaatgttt
caaagtgactctgacgaactttgtcatgtccatgttctgctcctgttgacatccgggggc
ctctctagtgagactgttacatga

DBGET integrated database retrieval system